Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_LQSS01000096.1
FASTA Graphics
LOCUS NZ_LQSS01000096 799 bp DNA linear CON 12-JUN-2024 DEFINITION Escherichia coli strain GN02260 GCID_ECOLID_00028_NODE_90.ctg_1, whole genome shotgun sequence. ACCESSION NZ_LQSS01000096 NZ_LQSS01000000 VERSION NZ_LQSS01000096.1 DBLINK BioProject: PRJNA224116 BioSample: SAMN03922932 Assembly: GCF_001519555.1 KEYWORDS WGS; RefSeq. SOURCE Escherichia coli ORGANISM Escherichia coli Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia. REFERENCE 1 (bases 1 to 799) AUTHORS Adams,M., Sutton,G., Nelson,K., Thaden,J., Fowler,V., Mccorrison,J., Sanka,R., Brinkac,L. and Nierman,W. TITLE Direct Submission JOURNAL Submitted (11-JAN-2016) Informatics Core Services, JCVI, 9704 Medical Center Drive, Rockville, MD 20850, USA COMMENT REFSEQ INFORMATION: The reference sequence is identical to LQSS01000096.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: SPAdes v. 3.1.1 Genome Representation :: Full Expected Final Version :: Yes Genome Coverage :: 106.41x Sequencing Technology :: Illumina NextSeq 500 ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_001519555.1-RS_2024_06_12 Annotation Date :: 06/12/2024 02:04:27 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.7 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 5,144 CDSs (total) :: 5,073 Genes (coding) :: 4,839 CDSs (with protein) :: 4,839 Genes (RNA) :: 71 rRNAs :: 1, 1, 1 (5S, 16S, 23S) complete rRNAs :: 1, 1 (16S, 23S) partial rRNAs :: 1 (5S) tRNAs :: 62 ncRNAs :: 6 Pseudo Genes (total) :: 234 CDSs (without protein) :: 234 Pseudo Genes (ambiguous residues) :: 0 of 234 Pseudo Genes (frameshifted) :: 83 of 234 Pseudo Genes (incomplete) :: 174 of 234 Pseudo Genes (internal stop) :: 42 of 234 Pseudo Genes (multiple problems) :: 55 of 234 Pseudo Genes (short protein) :: 1 of 234 CRISPR Arrays :: 2 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..799 /organism="Escherichia coli" /mol_type="genomic DNA" /submitter_seqid="GCID_ECOLID_00028_NODE_90.ctg_1" /strain="GN02260" /isolation_source="Bodily fluid" /host="Homo sapiens" /db_xref="taxon:562" /geo_loc_name="USA" /lat_lon="36 N 78.9 W" /collection_date="2004" /collected_by="Vance Fowler" gene complement(120..737) /locus_tag="AWE80_RS28335" CDS complement(120..737) /locus_tag="AWE80_RS28335" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_020240669.1" /GO_component="GO:0009279 - cell outer membrane [Evidence IEA]" /GO_function="GO:0015474 - autotransporter activity [Evidence IEA]" /GO_process="GO:0046819 - protein secretion by the type V secretion system [Evidence IEA]" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="autotransporter outer membrane beta-barrel domain-containing protein" /protein_id="WP_244469714.1" /translation="MFAPSLIEAPDGTDFSMFSAISQKTGLSNVTPILGTSDNGNGTN LAIIGFNSEPDKKAVSTAASFANSSYRLFSTEMNNLNKRMGDIRDSGEAGVWGRYMLG QGSGTDGYQNTYNHLQLGADKGIRIESAMLYTGLIFTHTSTNAELSGSYYSDTKSYGL GGYTSIFFDNGFYTDFIAKYIHSTNVYSYLSPSEPPRVSWRVFYL" CONTIG join(LQSS01000096.1:1..799) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on