U.S. flag

An official website of the United States government

Escherichia coli strain GN02260 GCID_ECOLID_00028_NODE_90.ctg_1, whole genome shotgun sequence

NCBI Reference Sequence: NZ_LQSS01000096.1

FASTA Graphics 

LOCUS       NZ_LQSS01000096          799 bp    DNA     linear   CON 12-JUN-2024
DEFINITION  Escherichia coli strain GN02260 GCID_ECOLID_00028_NODE_90.ctg_1,
            whole genome shotgun sequence.
ACCESSION   NZ_LQSS01000096 NZ_LQSS01000000
VERSION     NZ_LQSS01000096.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN03922932
            Assembly: GCF_001519555.1
KEYWORDS    WGS; RefSeq.
SOURCE      Escherichia coli
  ORGANISM  Escherichia coli
            Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria;
            Enterobacterales; Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 799)
  AUTHORS   Adams,M., Sutton,G., Nelson,K., Thaden,J., Fowler,V.,
            Mccorrison,J., Sanka,R., Brinkac,L. and Nierman,W.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2016) Informatics Core Services, JCVI, 9704
            Medical Center Drive, Rockville, MD 20850, USA
COMMENT     REFSEQ INFORMATION: The reference sequence is identical to
            LQSS01000096.1.
            The annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (PGAP). Information about PGAP can be found here:
            https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: SPAdes v. 3.1.1
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 106.41x
            Sequencing Technology  :: Illumina NextSeq 500
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI RefSeq
            Annotation Name                   :: GCF_001519555.1-RS_2024_06_12
            Annotation Date                   :: 06/12/2024 02:04:27
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline (PGAP)
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS-2+
            Annotation Software revision      :: 6.7
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA
            Genes (total)                     :: 5,144
            CDSs (total)                      :: 5,073
            Genes (coding)                    :: 4,839
            CDSs (with protein)               :: 4,839
            Genes (RNA)                       :: 71
            rRNAs                             :: 1, 1, 1 (5S, 16S, 23S)
            complete rRNAs                    :: 1, 1 (16S, 23S)
            partial rRNAs                     :: 1 (5S)
            tRNAs                             :: 62
            ncRNAs                            :: 6
            Pseudo Genes (total)              :: 234
            CDSs (without protein)            :: 234
            Pseudo Genes (ambiguous residues) :: 0 of 234
            Pseudo Genes (frameshifted)       :: 83 of 234
            Pseudo Genes (incomplete)         :: 174 of 234
            Pseudo Genes (internal stop)      :: 42 of 234
            Pseudo Genes (multiple problems)  :: 55 of 234
            Pseudo Genes (short protein)      :: 1 of 234
            CRISPR Arrays                     :: 2
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..799
                     /organism="Escherichia coli"
                     /mol_type="genomic DNA"
                     /submitter_seqid="GCID_ECOLID_00028_NODE_90.ctg_1"
                     /strain="GN02260"
                     /isolation_source="Bodily fluid"
                     /host="Homo sapiens"
                     /db_xref="taxon:562"
                     /geo_loc_name="USA"
                     /lat_lon="36 N 78.9 W"
                     /collection_date="2004"
                     /collected_by="Vance Fowler"
     gene            complement(120..737)
                     /locus_tag="AWE80_RS28335"
     CDS             complement(120..737)
                     /locus_tag="AWE80_RS28335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020240669.1"
                     /GO_component="GO:0009279 - cell outer membrane [Evidence
                     IEA]"
                     /GO_function="GO:0015474 - autotransporter activity
                     [Evidence IEA]"
                     /GO_process="GO:0046819 - protein secretion by the type V
                     secretion system [Evidence IEA]"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter outer membrane beta-barrel
                     domain-containing protein"
                     /protein_id="WP_244469714.1"
                     /translation="MFAPSLIEAPDGTDFSMFSAISQKTGLSNVTPILGTSDNGNGTN
                     LAIIGFNSEPDKKAVSTAASFANSSYRLFSTEMNNLNKRMGDIRDSGEAGVWGRYMLG
                     QGSGTDGYQNTYNHLQLGADKGIRIESAMLYTGLIFTHTSTNAELSGSYYSDTKSYGL
                     GGYTSIFFDNGFYTDFIAKYIHSTNVYSYLSPSEPPRVSWRVFYL"
CONTIG      join(LQSS01000096.1:1..799)
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.