Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: NZ_QJSN01000040.1
FASTA Graphics
LOCUS NZ_QJSN01000040 2539 bp DNA linear CON 23-SEP-2024 DEFINITION Staphylococcus sp. AtHG25 Ga0060195_140, whole genome shotgun sequence. ACCESSION NZ_QJSN01000040 NZ_QJSN01000000 VERSION NZ_QJSN01000040.1 DBLINK BioProject: PRJNA224116 BioSample: SAMN06161130 Assembly: GCF_003217445.1 KEYWORDS WGS; RefSeq. SOURCE Staphylococcus sp. AtHG25 ORGANISM Staphylococcus sp. AtHG25 Bacteria; Bacillati; Bacillota; Bacilli; Bacillales; Staphylococcaceae; Staphylococcus. REFERENCE 1 (bases 1 to 2539) AUTHORS Partida-Martinez,L. TITLE The Agave Microbiome: Exploring the role of microbial communities in plant adaptations to desert environments JOURNAL Unpublished REFERENCE 2 (bases 1 to 2539) AUTHORS Partida-Martinez,L., Huntemann,M., Clum,A., Pillay,M., Palaniappan,K., Varghese,N., Mikhailova,N., Stamatis,D., Reddy,T., Daum,C., Shapiro,N., Ivanova,N., Kyrpides,N. and Woyke,T. TITLE Direct Submission JOURNAL Submitted (04-JUN-2018) Prokaryotic Super Group, DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598, USA COMMENT REFSEQ INFORMATION: The reference sequence is identical to QJSN01000040.1. The annotation was added by the NCBI Prokaryotic Genome Annotation Pipeline (PGAP). Information about PGAP can be found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/ ##Genome-Assembly-Data-START## Assembly Method :: SPAdes v. 3.10.1 Expected Final Version :: No Genome Coverage :: 472.0x Sequencing Technology :: Illumina HiSeq ##Genome-Assembly-Data-END## ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Name :: GCF_003217445.1-RS_2024_09_23 Annotation Date :: 09/23/2024 01:03:09 Annotation Pipeline :: NCBI Prokaryotic Genome Annotation Pipeline (PGAP) Annotation Method :: Best-placed reference protein set; GeneMarkS-2+ Annotation Software revision :: 6.8 Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA Genes (total) :: 2,488 CDSs (total) :: 2,408 Genes (coding) :: 2,290 CDSs (with protein) :: 2,290 Genes (RNA) :: 80 rRNAs :: 6, 6, 6 (5S, 16S, 23S) complete rRNAs :: 6, 1 (5S, 16S) partial rRNAs :: 5, 6 (16S, 23S) tRNAs :: 58 ncRNAs :: 4 Pseudo Genes (total) :: 118 CDSs (without protein) :: 118 Pseudo Genes (ambiguous residues) :: 0 of 118 Pseudo Genes (frameshifted) :: 35 of 118 Pseudo Genes (incomplete) :: 81 of 118 Pseudo Genes (internal stop) :: 30 of 118 Pseudo Genes (multiple problems) :: 24 of 118 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2539 /organism="Staphylococcus sp. AtHG25" /mol_type="genomic DNA" /submitter_seqid="Ga0060195_140" /strain="AtHG25" /db_xref="taxon:1938895" gene complement(<1..128) /locus_tag="BDW31_RS12300" /old_locus_tag="BDW31_1401" /pseudo CDS complement(<1..128) /locus_tag="BDW31_RS12300" /old_locus_tag="BDW31_1401" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_001105942.1" /note="incomplete; too short partial abutting assembly gap; missing C-terminus; Derived by automated computational analysis using gene prediction method: Protein Homology." /pseudo /codon_start=1 /transl_table=11 /product="IS6 family transposase" gene complement(<186..434) /locus_tag="BDW31_RS12305" /old_locus_tag="BDW31_1402" /pseudo CDS complement(<186..434) /locus_tag="BDW31_RS12305" /old_locus_tag="BDW31_1402" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_020368559.1" /note="incomplete; partial in the middle of a contig; missing C-terminus; Derived by automated computational analysis using gene prediction method: Protein Homology." /pseudo /codon_start=1 /transl_table=11 /product="protein rep" gene 747..1421 /locus_tag="BDW31_RS12310" /old_locus_tag="BDW31_1403" CDS 747..1421 /locus_tag="BDW31_RS12310" /old_locus_tag="BDW31_1403" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_011304063.1" /GO_component="GO:0016020 - membrane [Evidence IEA]" /GO_function="GO:0015267 - channel activity [Evidence IEA]" /GO_process="GO:0055085 - transmembrane transport [Evidence IEA]" /note="Derived by automated computational analysis using gene prediction method: Protein Homology." /codon_start=1 /transl_table=11 /product="aquaporin" /protein_id="WP_011304063.1" /translation="MRKIIAEFLGTFILVFFGTGTAVFMSLSPDNSVGTLGVAIAFGL TIIAAAYAIGDISGGHLNPAVSLGMFLDKRLSLINLFIYTISQTMGAIFATFLIWSIS STLKTDLDQYGANLPGDLSLSGAFLVEVILTFVFVFIVLSVTTTKFIAPNLAVLVIGF TLTMVHLIGIPLTGTSVNPARSIGPALFTGGEALSTLWIFILAPLLGAVIAALTHKIL RKPNIQ" gene complement(2273..>2356) /locus_tag="BDW31_RS12825" /pseudo CDS complement(2273..>2356) /locus_tag="BDW31_RS12825" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_001568503.1" /note="incomplete; partial in the middle of a contig; missing N-terminus; Derived by automated computational analysis using gene prediction method: Protein Homology." /pseudo /codon_start=1 /transl_table=11 /product="replication protein" gene 2412..>2539 /locus_tag="BDW31_RS12315" /old_locus_tag="BDW31_1406" /pseudo CDS 2412..>2539 /locus_tag="BDW31_RS12315" /old_locus_tag="BDW31_1406" /inference="COORDINATES: similar to AA sequence:RefSeq:WP_001105942.1" /note="incomplete; too short partial abutting assembly gap; missing C-terminus; Derived by automated computational analysis using gene prediction method: Protein Homology." /pseudo /codon_start=1 /transl_table=11 /product="IS6 family transposase" CONTIG join(QJSN01000040.1:1..2539) //
Whole sequence (abbreviated view) Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on