Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: OP649608.1
FASTA Graphics PopSet
LOCUS OP649608 615 bp DNA linear BCT 08-MAY-2023 DEFINITION Pantoea agglomerans strain PvCl-OF148 translation initiation factor IF-2 (infB) gene, partial cds. ACCESSION OP649608 VERSION OP649608.1 KEYWORDS . SOURCE Pantoea agglomerans ORGANISM Pantoea agglomerans Bacteria; Pseudomonadati; Pseudomonadota; Gammaproteobacteria; Enterobacterales; Erwiniaceae; Pantoea; Pantoea agglomerans group. REFERENCE 1 (bases 1 to 615) AUTHORS Zamorano,A., Zuniga,T., Cordova,P., Higuera,G., Bertaccini,A. and Fiore,N. TITLE Pantoea agglomerans as the causal agent of necrotic disease and decay of pistachio tree JOURNAL Unpublished REFERENCE 2 (bases 1 to 615) AUTHORS Zamorano,A., Zuniga,T. and Fiore,N. TITLE Direct Submission JOURNAL Submitted (14-OCT-2022) Sanidad Vegetal, Universidad de Chile, Santa Rosa 11315, la Pintana, Santiago 8820808, Chile COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..615 /organism="Pantoea agglomerans" /mol_type="genomic DNA" /strain="PvCl-OF148" /isolation_source="twig" /host="Pistacia vera" /db_xref="taxon:549" /geo_loc_name="Chile" /collection_date="Jan-2017" gene <1..>615 /gene="infB" CDS <1..>615 /gene="infB" /codon_start=1 /transl_table=11 /product="translation initiation factor IF-2" /protein_id="WGT79753.1" /translation="AMRARGAQATDIVILVVAADDGVMPQTVEAIQHAKAAKVPVVVA VNKCDKPEADPDRVKNELTQYGIIPEEWGGEYMFVNVSAKAGTGIDDLLNAILLQAEV LELTAIREGMASGVVIESFLDKGRGPVATVLVREGTLNKGDIVLCGFEYGRVRAMRDE LGREVMEAGPSIPVEILGLSGVPAAGDEATVVRDEKKAREVALYR" ORIGIN 1 gcgatgcgtg cacgtggtgc gcaggcgacc gatatcgtta tcctggtggt tgcagcagac 61 gatggcgtga tgccacagac tgtcgaagct attcagcacg ccaaagccgc taaagtgccg 121 gttgtggttg cagtgaacaa gtgcgataag ccagaagcgg atccggatcg tgttaaaaac 181 gaactgactc agtacggtat cattccggaa gagtggggcg gtgaatacat gttcgttaat 241 gtctctgcga aagcgggtac cggcattgat gacctgttaa acgctatcct gctgcaggcg 301 gaagtgctgg aactgaccgc tatccgtgaa ggtatggcga gcggcgtggt gatcgaatcg 361 ttcctcgaca aaggtcgtgg tccggttgcc accgtgctgg tacgtgaagg tacgctgaac 421 aaaggcgaca tcgttctttg tggtttcgaa tatggccgcg ttcgtgcaat gcgtgacgaa 481 ctgggtcgcg aagtcatgga agcgggtcca tctatcccgg ttgagattct gggcctgtcc 541 ggcgtgccgg ctgcgggtga tgaagcgacc gtagtacgtg acgagaagaa agcacgtgaa 601 gttgcgctct atcgt //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on