Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: S73614.1
FASTA Graphics
LOCUS S73614 319 bp mRNA linear PRI 26-JUL-2016 DEFINITION Homo sapiens transgenic-JHD mouse #2357 immunoglobulin heavy chain variable region (IgG VH251) mRNA, partial cds. ACCESSION S73614 VERSION S73614.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 319) AUTHORS Taylor,L.D., Carmack,C.E., Huszar,D., Higgins,K.M., Mashayekh,R., Sequar,G., Schramm,S.R., Kuo,C.C., O'Donnell,S.L., Kay,R.M. et,al. TITLE Human immunoglobulin transgenes undergo rearrangement, somatic mutation and class switching in mice that lack endogenous IgM JOURNAL Int. Immunol. 6 (4), 579-591 (1994) PUBMED 8018598 REMARK GenBank staff at the National Library of Medicine created this entry [NCBI gibbsq 155915] from the original journal article. FEATURES Location/Qualifiers source 1..319 /organism="Homo sapiens" /mol_type="mRNA" /isolate="transgenic-JHD mouse #2357" /db_xref="taxon:9606" /clone="g1" gene 1..319 /gene="IgG VH251" /note="immunoglobulin heavy chain variable region" CDS <1..294 /gene="IgG VH251" /note="immunoglobulin heavy chain variable region" /codon_start=1 /protein_id="AAD14969.2" /translation="SLKISCKGSGYSFSDYWIGWVRQMPGKGLEWMGIIYPGDSDTRY SPSFQGQVSISVDKSINTAFLQWNTLEASDTAMYYCARGYYYDSGTYYKSTLL" ORIGIN 1 tctctgaaga tctcctgtaa gggttctgga tacagttttt ccgactactg gatcggctgg 61 gtgcgccaga tgcccgggaa aggcctggag tggatgggga tcatctatcc tggtgactct 121 gacaccagat acagcccgtc cttccagggc caggtctcca tctcagtcga caagtccatc 181 aacaccgcct tcctgcagtg gaacaccctg gaggcttcgg acaccgccat gtattactgt 241 gcgagagggt attattatga ttcggggact tattataagt ctaccctact ttgactattg 301 gggccaggga accctggtc //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on