Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_001078790.1
FASTA Graphics
LOCUS XM_001078790 3055 bp mRNA linear ROD 22-JUN-2006 DEFINITION PREDICTED: Rattus norvegicus similar to CDNA sequence BC063749 (predicted) (RGD1564255_predicted), mRNA. ACCESSION XM_001078790 VERSION XM_001078790.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_001084773) annotated using gene prediction method: GNOMON, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process [WARNING] On May 11, 2008 this sequence was replaced by NM_001127303.1. FEATURES Location/Qualifiers source 1..3055 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="Celera" /db_xref="taxon:10116" /chromosome="1" gene 1..3055 /gene="RGD1564255_predicted" /note="Derived by automated computational analysis using gene prediction method: GNOMON. Supporting evidence includes similarity to: 1 mRNA, 15 ESTs, 2 Proteins" /db_xref="GeneID:499253" /db_xref="RGD:1564255" CDS 638..2245 /gene="RGD1564255_predicted" /codon_start=1 /product="hypothetical protein" /protein_id="XP_001078790.1" /db_xref="GeneID:499253" /db_xref="RGD:1564255" /translation="MSVRYTLNLRVFWPLVTGLCTALVCLYHALRSSEGARAEPPDGA DSGFPLLKVAILLLLCYILLRCRHTIRQRLLPGSSRPCGHANFSARSLQEPGLSILLE SYYEHEVRLSPHVLGHSKAHVSRIVGELVQAGRARGSPGPITGGALALAFRGDFIQVG SAYEQHKIRRPDSFDVLVPLRLPPQVALEPRSLGTEPALTPAFRSCFVCTLKAPPSPS GTSTGQWHRDCKPFAEGFCVDVQGRRHLSATLVLRWFQAHLQRSLATVRYSLEGRCRV SLTPGGLEQPPTLHILPCRTDYGCCRLSMAVRLIPAVHLGEGVFLVAPPPPPSPSGAL SELPGGLRAEALWGVNTARQEQKLLGWLQERAPPGACYLKCLQLLKALRDLGARGLDP MAATHWGRILSSYMLKTAVLEVLLNEGGPTPSWDEAYLSECLEKLVKFLRDCLLRRRD LFHCVLGPAGAAAEVGPLPKVLREAPPVDLLAPFDQHARELAAARLLSTWRRLPQLLQ VYGGPRYLARCPAPRSQRIQGFPEDEP" ORIGIN 1 ggtgggactg caagccttcc tccggcaact tcccagtaag tgcgggatca gatgcagcca 61 ccgccccgga accaggcctt ccctgttctg ccttccagga ggggacccag gaatagccct 121 cgggaaggca gtctcccgca agtcccgaag tccttctggc cacccggcgt cgaaccaggc 181 ggaggctagg aggggaccgc cctccccgcg aggctccaga ctccggcact tcctcccggc 241 tgcccggcgc ggccttcccc tccgaaagaa gaaaatctcg gggcccgagt aacccggcgg 301 atcgccccgg tgcgcagctg cgctggagcc aggagggccg cccagggtag ggtagaagtc 361 cggggcagaa gccagccgag ggcagcgcgg ctgagactga gcgggacagg aacagggcgc 421 ggtcaggggc cgaagcgagc tgcgcgggcg gcgcctggaa ggggaacttg agctgggagt 481 ggaggctgag cagcggtact gctggccccg gcgctgcgag cccggagcct cctccaaggc 541 caaggacacg ggggcctcgg ggccgccggg acgccgcgcg catgctgggc aggggacacc 601 acccgggctc gcgccctggg ccgcccgggc tcccggcatg tccgtgcggt acacgctcaa 661 cctgagggtc ttctggccct tggtgaccgg gctgtgcacg gcgctagtgt gcctctacca 721 tgccctacgc agcagcgagg gtgcccgggc cgagcccccc gacggcgcag acagcggctt 781 cccgctgctc aaggtggcta tccttcttct cctctgctac atcctcctac gatgtcgcca 841 caccatccgc cagcgcctct tgccaggctc ttcccgccca tgtggccatg ccaacttctc 901 agccagatcc ttgcaagagc caggcctgag catcttgctg gagagttact atgagcacga 961 agtgcgccta tcgccacatg tgctaggtca cagcaaggcg catgtgagcc ggatcgtagg 1021 ggaactggtg caagctggcc gagcccgagg gtctccgggc cccatcaccg gtggagcgct 1081 ggctttggcc ttccggggag acttcatcca ggtgggcagc gcctacgaac agcataaaat 1141 ccggcgaccc gacagcttcg acgtgctggt gccactgaga ctcccgccgc aggtggcgct 1201 ggagccacgg agcctaggga ctgaacctgc tctgaccccg gccttccgca gctgcttcgt 1261 gtgcaccctc aaggcaccgc cctcgccatc ggggacctcg acgggccagt ggcatcgcga 1321 ctgcaagccc ttcgctgaag gcttctgtgt ggatgtgcag ggccgtcgcc acctctcagc 1381 taccctggtg ctgcgctggt tccaggcgca cctacagcgc tccttggcca ccgtgcgcta 1441 cagtttggag ggtcgctgtc gcgtcagcct gaccccaggg ggtctggagc agcctcccac 1501 ccttcacatc cttccctgcc gcacggacta tggctgctgc cgcctttcca tggccgtgcg 1561 cctcatcccg gctgtccacc tgggtgaagg cgtcttcctt gtggcaccgc cgccaccacc 1621 ctcgcctagc ggggctctgt cagagctccc aggtggcctg cgtgctgagg cactgtgggg 1681 tgtgaacaca gcacgtcagg agcagaaact gctgggctgg cttcaggaac gggcgcctcc 1741 aggtgcctgc tacctcaagt gcctgcagct gcttaaggcc cttcgagact tgggtgcccg 1801 cgggctggac ccgatggctg ctacacactg gggacgcatc ctgtcctcct acatgctcaa 1861 aacagcggtg ctcgaggtgc ttctgaatga ggggggccca acacctagct gggacgaggc 1921 atacctgagt gagtgcttgg agaagttggt gaagttcctt agggactgcc tgctgcgacg 1981 ccgagacctc ttccattgtg tcctaggtcc ggctggggca gctgccgaag ttggacccct 2041 gcccaaggtg ctgcgtgagg cccctccagt tgacctcctg gcacccttcg accagcatgc 2101 ccgggagctt gcagcagcgc ggttactgtc cacctggcga aggttgcccc agcttctcca 2161 ggtctatggt ggtccccgtt accttgccag gtgtcctgca ccccggagtc aacgcatcca 2221 gggcttcccg gaagatgaac catgaacact gattacacac cactgaccaa atgccccttt 2281 cccacggatg agagcaccga tggcagctaa ataacagatg agctgtccca ggtgttggaa 2341 aatttgaagg atgtcacagg atttggtggc acgaatgttc tgtcctaggc tccctggcct 2401 aagatagcag tggcatcttc tgcagaccta gtagagtatc ctgggtggtc ttatacaccg 2461 atctctctgt cccccaaatt attaaaagca atcatttttt atttacttac tgggtagata 2521 ctaggttctc aattggccca tagttttgga ggggcattgt atgtatgttt caatgctggg 2581 gctggaatcc tatgctaggc tggccctcta ccacgaagct acgtcctagg cccctacttt 2641 gtttttgttt tgtttttaag gaatccttat ccacaactgg aattgagatt ctagtccagc 2701 tgttagcatc ccagagtcct aacttagtta tttccatgac catgcatgta ttttttcgta 2761 gtgcaatcac aggtttgttg aataagacta atggagttgt cataaattaa gtgactcaca 2821 tgctaagagg tggccaagag ctggttagag actttcagag caagtggcat tttatgtcca 2881 gtcatttttt tttttgttct gtttttgtca gaaccaaggg ctgttccaaa gagcttctgc 2941 acagttatat gaaagaccag ggctctgaag agcagccgtt cagcgctctt ccaggtcaca 3001 ggtggggatc tgcacttgac actcaatacc tattagtctg agccaggcag aatgc //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on