Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_006534535.5
FASTA Graphics
LOCUS XM_006534535 2467 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus cystinosis, nephropathic (Ctns), transcript variant X4, mRNA. ACCESSION XM_006534535 VERSION XM_006534535.5 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_000077.7) annotated using gene prediction method: Gnomon, supported by mRNA and EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 21, 2020 this sequence version replaced XM_006534535.4. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001635.27-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2467 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="11" gene 1..2467 /gene="Ctns" /note="cystinosis, nephropathic; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 10 ESTs, 290 long SRA reads, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns" /db_xref="GeneID:83429" /db_xref="MGI:MGI:1932872" CDS 366..1145 /gene="Ctns" /codon_start=1 /product="cystinosin isoform X3" /protein_id="XP_006534598.1" /db_xref="GeneID:83429" /db_xref="MGI:MGI:1932872" /translation="MNPRIRFLVIHSRIVSIINQVIGWIYFMAWSVSFYPQVIQNWRR KSVIGLSFDFLALNLTGFVAYSVFNIGLLWVPYIQEEFLLKYPNGVNPVDSNDAFFSL HAVALTLIVILQCCLYERGNQRVSWPSIGFLVLAWLFVLVTMIVAAVGITTWLQFLFC FSYIKLIITLIKYFPQAYMNFYYKSTKGWSIGGVLLDFTGGSFSLLQMFLQSYNNDQW TLIFGDPTKFGLGVFTIFFDVVFFIQHFYLYRKKPGYDQLN" ORIGIN 1 tgacagctgg cccctctttc acacaaagtc ggcggagctc agagagtcct tacactccta 61 agcggtttct ggtgcgagat tgttgctttt ggtgaggtct gtccaccaag cctgggaagc 121 tgtcagttct gagaagtcag agaccatgag gaggaattgg ctgcttattt tgaccctttt 181 tctcttgatg ttcatagaga agtatgagtc aactgtcagt ctcactgctc ctcccaccgt 241 gaagctggaa aatggcagtt caaccaacgt cgacatcacc cttgggcatc cactaaattc 301 gaccttggtg atcacttttg aagtcacgtt tcgctcaaaa aatctgacta ttgtggagct 361 tcctgatgaa ccccaggatc cggttcttgg tgatacacag cagaatcgtt agcatcataa 421 accaggtgat tggctggatc tacttcatgg cgtggtctgt ctccttttac ccacaagtga 481 tccagaactg gagacggaaa agtgtcattg gtctcagctt tgatttcttg gccctgaact 541 tgacgggctt cgtggcctac agtgttttca acatcggtct tttgtgggtg ccctatatcc 601 aggaggagtt tctcctcaaa taccccaatg gtgtgaaccc cgtcgacagt aatgatgcct 661 tcttcagctt gcatgctgtc gccctcaccc tgattgtcat cctgcagtgc tgcctgtatg 721 agcgaggcaa ccagcgtgtg tcatggccct ccattggctt cctggtactc gcatggctct 781 ttgtcctagt caccatgatt gtggctgcag tcggtatcac cacatggctc cagttcctct 841 tctgcttctc ctacatcaag ctcatcatca cactgatcaa gtatttccca caggcctata 901 tgaacttcta ctacaaaagc accaagggct ggagcattgg cggtgtgctc ctcgatttta 961 cagggggcag ctttagcctc ctccagatgt tcctccagtc ttacaataat gaccaatgga 1021 cattgatctt cggagaccca accaagttcg gacttggcgt cttcaccatc ttctttgatg 1081 ttgtcttctt catccagcac ttctacttgt acagaaagaa accagggtac gaccagttga 1141 attagaatcc agagacccag tgtaaacagc cagggcctgg gccctggtag gaaaggttgt 1201 atccagcaaa ggccagagaa gcagctggca cacagggctg gaacagtatg ccaacaagag 1261 cagcattctc ttcctcaaga atcaaaagcc ttaagctcag cctgcctgtc ttcatccagg 1321 cctctcctga accatggagg actccctctc tggaacagac acctgactct gcttgagact 1381 gaaagctaga cttgaggcag tctctcccaa ctttaaagct ccagccctct gctggaggca 1441 cccagccctc ctgcgtcttg atataccatc tctctctctt taaggcttca ggcagcacac 1501 acaggtccag acagccatcc cagccagaac tgggcatcat gtttgcagct gatgaccttg 1561 ccccaaagca ccaatatttc tgggagcagc ttgaaaagct aaccttgcaa ctgggagagc 1621 caagggtgct ttgtcccacc acagtgttca cagagaccaa gcagccaggt gctgtggccc 1681 atggacttga aggtgctgat gctggtggtg gaggggagag aactgtggga tcaagctttg 1741 gggtccttgc tctcggggcc actttcctta tgctcattct atataacgct gctctagtaa 1801 ctgcagaaca agaggcccag gccagtgcct ggtaaagtat atttctgatc cctgaggtgc 1861 ctgccagatt ggtctgaagt ggacccgtac ctgctgccct ccggatcttt gcacacaaag 1921 ataccacagt acctttttta tttttatttt acctccaagg tatattttaa aatggctttt 1981 cttttgccct ctttcctacc tccactttct gagagtcgga tggagcacca tcttgagtcc 2041 ccagactccc cgtaacctta cacctatgga gcaggtactc aggaccagcc tgtgccttag 2101 aagcccatca gtcaatcagt aagctgccct ggatgggaag ggaggcctcc ttccccagcc 2161 ccagactgag actccaactc ctcagctgtt gaggagcctc agcgcacagg ggcttacctc 2221 ctatgttgct tgtggtccca ccctgatccc acacctcctt ccttctcatc ccattattct 2281 tcctacgcca ggtagggaag gaaccagggt gtgccttgag tttatcaatc tgtttctttt 2341 gtttcttata agacgaatat tgagggatcc ttgtatttct ttcttttgta tttttttctt 2401 gttcggtttc atttttgtgg cgtgtgtgtg tgtccttaat taaaaggtgg tttgtttctt 2461 atttgta //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on