Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_006540358.3
FASTA Graphics
LOCUS XM_006540358 1739 bp mRNA linear ROD 07-FEB-2024 DEFINITION PREDICTED: Mus musculus doublesex and mab-3 related transcription factor like family C2 (Dmrtc2), transcript variant X2, mRNA. ACCESSION XM_006540358 VERSION XM_006540358.3 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_000073.7) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Aug 8, 2019 this sequence version replaced XM_006540358.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001635.27-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/01/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1739 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6J" /db_xref="taxon:10090" /chromosome="7" gene 1..1739 /gene="Dmrtc2" /gene_synonym="4933432E21Rik; Dmrt7" /note="doublesex and mab-3 related transcription factor like family C2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 ESTs, 2 long SRA reads, 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:71241" /db_xref="MGI:MGI:1918491" CDS 207..1349 /gene="Dmrtc2" /gene_synonym="4933432E21Rik; Dmrt7" /codon_start=1 /product="doublesex- and mab-3-related transcription factor C2 isoform X2" /protein_id="XP_006540421.1" /db_xref="GeneID:71241" /db_xref="MGI:MGI:1918491" /translation="MTAGRGAPKSMDPSETAALHHCSADSSPADEARVPQSTELIPRR PVSRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQE AQLKRHLAQGLMKGATPLKAPLRVKKGAIRPGIPSGKENIAPQPQSPHGAVPLVLTPP GKENYGPLLLSRPPEALPLPWTPVPPGPWGPGHWLPPGLSMPPPVVCRLLCQEPAVPL HPFPGFDPGTSLRLPTHGTLPTCPGSRSVLTAPLSGEPQGPPNLPHTCSTLILQSCGT PDSLLLQPQAPGASCLAWTSGPSERQLQREAAEALVGLKDSSQAPRLTPSVPPNPAWI SLLHPCGPPAPPGGRGFQPVGPPLRPSPGSSVSLHIGRLGSISLLS" ORIGIN 1 acccgctggc ggcatgaaca tcataccgcc cctccttgcc ccgcctctcc tgagctgggt 61 ccccaccatg gcctcccctt gttgccccct cgcgctgctc agctctaccc cccaccccca 121 cctcctgagc gcggtcctcg tgcccagccc cctccctggg accctggggc gggaggggcc 181 gcaggcccag cgtttggggg tgatggatga ctgctggaag gggggcaccc aaatccatgg 241 accccagtga aacggctgct ctccaccact gttctgctga ctcttcccca gccgacgagg 301 ccagagtgcc ccagagtaca gagcttattc ccaggagacc agtcagtcgc tctccaacct 361 gtgcccgctg tcgcaaccat ggggtcacag cccatctcaa gggacacaag cgcctctgcc 421 tctttcaggc ttgcgagtgt cacaaatgtg tcctcatcct ggaacgtcgg agggtcatgg 481 ctgcccaagt ggccttgcgc aggcagcagg aggcacagct gaaaaggcac ctggctcagg 541 gactgatgaa aggggcaacc cctctgaaag ctcccctccg tgtcaagaag ggagccattc 601 ggccagggat cccttctgga aaagagaaca tagcacccca gcctcagagt ccccatggag 661 cagtcccact ggtactgaca ccccctggga aggagaacta tgggccactg ctgctcagcc 721 gccccccgga agccttgcct ttgccctgga ctccagtgcc tcctgggcct tggggccctg 781 gacactggct gcccccaggc ctctcaatgc cacctccagt ggtatgccgc ttgctgtgcc 841 aagaacctgc tgtccctcta catccttttc ctggctttga ccctggcacc tctctccggc 901 tgcccactca tgggaccctc ccgacctgcc caggatctcg ctcagtactg acggctccac 961 tttctgggga gccccaagga ccccctaacc tgcctcacac atgttcaact ctgatactcc 1021 agtcctgtgg caccccagac tctcttctgc tacagccaca ggcccctgga gcctcctgcc 1081 tggcctggac atctggcccc tcggagcggc agctgcagcg ggaggcagct gaggcccttg 1141 taggtctgaa agactcatcc caggctcccc gcctgacccc atctgtcccc cctaaccctg 1201 cctggatctc tctgctccac ccctgtggcc caccagctcc tcctggggga agaggattcc 1261 agcctgttgg cccacctctc cgacccagtc caggttcctc tgtctctctg cacattgggc 1321 gtctgggatc tatctccctc ctcagctaga cagcagaggt ggaggctacc tcactgggac 1381 aaagagacga caaactgcag gcactgcata tttggtattt tatttatggt tttgcatggg 1441 atttaatgta atgcaagctt cagctttttt ttttatataa gctttcaggt tcctttttta 1501 gtgtgggtat tttcttgact gagggtggct attcttgtag cccgtttaaa tactaagtcc 1561 cccaataaag gcagttgggc agtttaagat gacccatatc taaatacatt ttttcatgag 1621 tttatgctct ctatatgcct atgttcttat gtctgtctct gaatgtgaaa atacaagaat 1681 atgttcactt tgtatgtagg tttctgtaag caagaaataa acctttgcca tctaagcca //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on