U.S. flag

An official website of the United States government

PREDICTED: Mus musculus doublesex and mab-3 related transcription factor like family C2 (Dmrtc2), transcript variant X2, mRNA

NCBI Reference Sequence: XM_006540358.3

FASTA Graphics 

LOCUS       XM_006540358            1739 bp    mRNA    linear   ROD 07-FEB-2024
DEFINITION  PREDICTED: Mus musculus doublesex and mab-3 related transcription
            factor like family C2 (Dmrtc2), transcript variant X2, mRNA.
ACCESSION   XM_006540358
VERSION     XM_006540358.3
DBLINK      BioProject: PRJNA169
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_000073.7) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Aug 8, 2019 this sequence version replaced XM_006540358.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_000001635.27-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/01/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1739
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6J"
                     /db_xref="taxon:10090"
                     /chromosome="7"
     gene            1..1739
                     /gene="Dmrtc2"
                     /gene_synonym="4933432E21Rik; Dmrt7"
                     /note="doublesex and mab-3 related transcription factor
                     like family C2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 4 ESTs, 2 long SRA reads,
                     5 Proteins, and 100% coverage of the annotated genomic
                     feature by RNAseq alignments, including 1 sample with
                     support for all annotated introns"
                     /db_xref="GeneID:71241"
                     /db_xref="MGI:MGI:1918491"
     CDS             207..1349
                     /gene="Dmrtc2"
                     /gene_synonym="4933432E21Rik; Dmrt7"
                     /codon_start=1
                     /product="doublesex- and mab-3-related transcription
                     factor C2 isoform X2"
                     /protein_id="XP_006540421.1"
                     /db_xref="GeneID:71241"
                     /db_xref="MGI:MGI:1918491"
                     /translation="MTAGRGAPKSMDPSETAALHHCSADSSPADEARVPQSTELIPRR
                     PVSRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMAAQVALRRQQE
                     AQLKRHLAQGLMKGATPLKAPLRVKKGAIRPGIPSGKENIAPQPQSPHGAVPLVLTPP
                     GKENYGPLLLSRPPEALPLPWTPVPPGPWGPGHWLPPGLSMPPPVVCRLLCQEPAVPL
                     HPFPGFDPGTSLRLPTHGTLPTCPGSRSVLTAPLSGEPQGPPNLPHTCSTLILQSCGT
                     PDSLLLQPQAPGASCLAWTSGPSERQLQREAAEALVGLKDSSQAPRLTPSVPPNPAWI
                     SLLHPCGPPAPPGGRGFQPVGPPLRPSPGSSVSLHIGRLGSISLLS"
ORIGIN      
        1 acccgctggc ggcatgaaca tcataccgcc cctccttgcc ccgcctctcc tgagctgggt
       61 ccccaccatg gcctcccctt gttgccccct cgcgctgctc agctctaccc cccaccccca
      121 cctcctgagc gcggtcctcg tgcccagccc cctccctggg accctggggc gggaggggcc
      181 gcaggcccag cgtttggggg tgatggatga ctgctggaag gggggcaccc aaatccatgg
      241 accccagtga aacggctgct ctccaccact gttctgctga ctcttcccca gccgacgagg
      301 ccagagtgcc ccagagtaca gagcttattc ccaggagacc agtcagtcgc tctccaacct
      361 gtgcccgctg tcgcaaccat ggggtcacag cccatctcaa gggacacaag cgcctctgcc
      421 tctttcaggc ttgcgagtgt cacaaatgtg tcctcatcct ggaacgtcgg agggtcatgg
      481 ctgcccaagt ggccttgcgc aggcagcagg aggcacagct gaaaaggcac ctggctcagg
      541 gactgatgaa aggggcaacc cctctgaaag ctcccctccg tgtcaagaag ggagccattc
      601 ggccagggat cccttctgga aaagagaaca tagcacccca gcctcagagt ccccatggag
      661 cagtcccact ggtactgaca ccccctggga aggagaacta tgggccactg ctgctcagcc
      721 gccccccgga agccttgcct ttgccctgga ctccagtgcc tcctgggcct tggggccctg
      781 gacactggct gcccccaggc ctctcaatgc cacctccagt ggtatgccgc ttgctgtgcc
      841 aagaacctgc tgtccctcta catccttttc ctggctttga ccctggcacc tctctccggc
      901 tgcccactca tgggaccctc ccgacctgcc caggatctcg ctcagtactg acggctccac
      961 tttctgggga gccccaagga ccccctaacc tgcctcacac atgttcaact ctgatactcc
     1021 agtcctgtgg caccccagac tctcttctgc tacagccaca ggcccctgga gcctcctgcc
     1081 tggcctggac atctggcccc tcggagcggc agctgcagcg ggaggcagct gaggcccttg
     1141 taggtctgaa agactcatcc caggctcccc gcctgacccc atctgtcccc cctaaccctg
     1201 cctggatctc tctgctccac ccctgtggcc caccagctcc tcctggggga agaggattcc
     1261 agcctgttgg cccacctctc cgacccagtc caggttcctc tgtctctctg cacattgggc
     1321 gtctgggatc tatctccctc ctcagctaga cagcagaggt ggaggctacc tcactgggac
     1381 aaagagacga caaactgcag gcactgcata tttggtattt tatttatggt tttgcatggg
     1441 atttaatgta atgcaagctt cagctttttt ttttatataa gctttcaggt tcctttttta
     1501 gtgtgggtat tttcttgact gagggtggct attcttgtag cccgtttaaa tactaagtcc
     1561 cccaataaag gcagttgggc agtttaagat gacccatatc taaatacatt ttttcatgag
     1621 tttatgctct ctatatgcct atgttcttat gtctgtctct gaatgtgaaa atacaagaat
     1681 atgttcactt tgtatgtagg tttctgtaag caagaaataa acctttgcca tctaagcca
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.