Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_011542084.4
FASTA Graphics
LOCUS XM_011542084 1079 bp mRNA linear PRI 25-AUG-2024 DEFINITION PREDICTED: Homo sapiens carbonic anhydrase 6 (CA6), transcript variant X1, mRNA. ACCESSION XM_011542084 VERSION XM_011542084.4 DBLINK BioProject: PRJNA168 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_000001.11) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Apr 5, 2022 this sequence version replaced XM_011542084.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001405.40-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1079 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" gene 1..1079 /gene="CA6" /gene_synonym="CA-VI; GUSTIN" /note="carbonic anhydrase 6; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns" /db_xref="GeneID:765" /db_xref="HGNC:HGNC:1380" /db_xref="MIM:114780" misc_feature 1 /gene="CA6" /gene_synonym="CA-VI; GUSTIN" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 8..982 /gene="CA6" /gene_synonym="CA-VI; GUSTIN" /codon_start=1 /product="carbonic anhydrase 6 isoform X1" /protein_id="XP_011540386.1" /db_xref="GeneID:765" /db_xref="HGNC:HGNC:1380" /db_xref="MIM:114780" /translation="MCSTMRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYP ACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMT VADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAP DGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYT YHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHR VVESNFPNQENAYIPSGKGHGGHRGRSQNPRVQPTSTRHPLALGSLEA" ORIGIN 1 attacagatg tgcagcacca tgagggccct ggtgcttctg ctgtccctgt tcctgctggg 61 tggccaggcc cagcatgtgt ctgactggac ctactcagaa ggggcactgg acgaagcgca 121 ctggccacag cactaccccg cctgtggggg ccagagacag tcgcctatca acctacagag 181 gacgaaggtg cggtacaacc cctccttgaa ggggctcaat atgacaggct atgagaccca 241 ggcaggggag ttccccatgg tcaacaatgg ccacacagtg cagatcagcc tgccctccac 301 catgcgcatg acagtggctg acggcactgt atacatagcc cagcagatgc actttcactg 361 gggaggtgcg tcctcggaga tcagcggctc tgagcacacc gtggacggga tcagacatgt 421 gatcgagatt cacattgttc actacaattc taaatacaag agctatgata tagcccaaga 481 tgcgccggat ggtttggctg tactggcagc cttcgttgag gtgaagaatt accctgaaaa 541 cacttattac agcaacttca tttctcatct ggccaacatc aagtacccag gacaaagaac 601 aaccctgact ggccttgacg ttcaggacat gctgcccagg aacctccagc actactacac 661 ctaccatggc tcactcacca cgcctccctg cactgagaac gtccactggt ttgtgctggc 721 agattttgtc aagctctcca ggacacaggt ttggaagctg gagaattcct tactggatca 781 ccgcaacaag accatccaca acgattaccg caggacccag cccctgaacc acagagtggt 841 ggaatccaac ttcccgaatc aggaaaacgc ctatatcccc tcaggcaagg gccacggggg 901 gcatcgtggg agaagccaaa atccaagagt acagcccacc tcaacacgcc accccttggc 961 tctgggcagc ttagaagcct gagttcaaac acagtgaaga tgactaaagg caatgcaccg 1021 ggcacgtgga gagcattcta aggaatcaaa agacttccca aaaatacgat gcgggtatg //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
SNP
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on