Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_017015279.2
FASTA Graphics
LOCUS XM_017015279 966 bp mRNA linear PRI 25-AUG-2024 DEFINITION PREDICTED: Homo sapiens multivesicular body subunit 12B (MVB12B), transcript variant X5, mRNA. ACCESSION XM_017015279 VERSION XM_017015279.2 DBLINK BioProject: PRJNA168 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_000009.12) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Apr 5, 2022 this sequence version replaced XM_017015279.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001405.40-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..966 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="9" gene 1..966 /gene="MVB12B" /gene_synonym="C9orf28; FAM125B" /note="multivesicular body subunit 12B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 9 long SRA reads, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns" /db_xref="GeneID:89853" /db_xref="HGNC:HGNC:23368" CDS 281..955 /gene="MVB12B" /gene_synonym="C9orf28; FAM125B" /codon_start=1 /product="multivesicular body subunit 12B isoform X5" /protein_id="XP_016870768.1" /db_xref="GeneID:89853" /db_xref="HGNC:HGNC:23368" /translation="MKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTE AAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSSAASTP APNLPRHISLTLPATFRGRNSTRTDYEYQHSNLYAISALPRSPPWQLLSSSAGSCEHH SLLYTLSYASQGPPPAHPLLWAQALLSEFPCPGNECPLRDHTYAASPALLRAVLCQII TLLLKS" polyA_site 966 /gene="MVB12B" /gene_synonym="C9orf28; FAM125B" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgtggatgct gacctctgga aagacggctt atttaaatcc aaggttacca gatacctgtg 61 tttcacaaga tcattttcca aagaaaatag acgtgacaca gtgcaggtgg aggtgggatc 121 ttggctccca tgtgcagaga tggaggtagc agcccttctt ctctaagcaa gatggaacaa 181 cagcctgaga agttgctgtc cagggcagag tgatggctga ccaactagat gcttgtccaa 241 ggatgctgaa caaagtcatc tggggaacgt gttagtagat atgaagctca ttgacatcaa 301 ggacacactg cctgtgggct tcatcccaat tcaggagacg gtggacacac aggaagtggc 361 ttttaggaag aagaggctgt gcattaaatt tattccacgg gattcaacgg aagctgcgat 421 ttgtgacatt cggatcatgg gccggaccaa gcaggccccg cctcagtaca cgtttattgg 481 ggaactgaac agcatgggga tctggtatcg aatgggcaga gtaccaagaa atcatgactc 541 atctcaaccc acaacgcctt cccagtcatc agctgcctcc accccagccc ccaaccttcc 601 caggcacatc tccctaacac ttcctgccac cttccgaggc aggaacagca cccggacgga 661 ctacgagtac cagcactcca atttgtatgc catatcagct cttcccagaa gccctccctg 721 gcagctcctg tcctcctctg ctggatcctg tgagcaccac agcctcctgt acaccctgag 781 ctatgcctct caaggccctc caccagctca tcccctgctg tgggcacaag ccctgctttc 841 agagtttccc tgcccaggga atgaatgccc cttgagagac cacacatatg ctgcaagtcc 901 agccctgctc agagccgttc tttgccaaat aatcaccttg ttattaaaga gctgattgtt 961 ctacta //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
SNP
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on