Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_047441901.1
FASTA Graphics
LOCUS XM_047441901 911 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens solute carrier family 25 member 43 (SLC25A43), transcript variant X1, mRNA. ACCESSION XM_047441901 VERSION XM_047441901.1 DBLINK BioProject: PRJNA168 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_000023.11) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001405.40-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..911 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="X" gene 1..911 /gene="SLC25A43" /note="solute carrier family 25 member 43; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 ESTs, 49 long SRA reads, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 34 samples with support for all annotated introns" /db_xref="GeneID:203427" /db_xref="HGNC:HGNC:30557" /db_xref="MIM:300641" CDS 69..878 /gene="SLC25A43" /codon_start=1 /product="solute carrier family 25 member 43 isoform X1" /protein_id="XP_047297857.1" /db_xref="GeneID:203427" /db_xref="HGNC:HGNC:30557" /db_xref="MIM:300641" /translation="MATWRRDGRLTGGQRLLCAGLAGTLSLSLTAPLELATVLAQVGV VRGHARGPWATGHRVWRAEGLRALWKGNAVACLRLFPCSAVQLAAYRKFVVLFTDDLG HISQWSSIMAGSLAGMVSTIVTYPTDLIKTRLIMQNILEPSYRGLLHAFSTIYQQEGF LALYRGVSLTVVGALPFSAGSLLVYMNLEKIWNGPRDQFSLPQNFANVCLAAAVTQTL SFPFETVKRKMQPTEQEEPHSSHSLPSSWPGTQHPECRLETLAPSTRTFIS" ORIGIN 1 acctccgccc gtggccggag agccccaggc ccgagccacg cggtcttccg ggcccgggtc 61 ggggctcgat ggctacgtgg aggcgggacg gccgactgac aggcggccaa aggctgctgt 121 gcgctgggct ggcggggacg ctcagcctca gcctcaccgc gcccctggag ctcgccaccg 181 tgctggccca ggttggcgtc gtgcgaggcc acgcccgggg accgtgggcc acagggcacc 241 gggtgtggcg ggcagagggg ctccgggccc tgtggaaggg gaacgcggtg gcgtgcctgc 301 gcctcttccc ctgcagcgcc gtgcagctcg ccgcctaccg caaatttgtt gtgctgttca 361 cagatgacct gggccacatt tcccagtgga gctccatcat ggctgggagt ctcgcaggca 421 tggtttccac cattgtaaca tatcctacag acctcatcaa aacccggttg atcatgcaga 481 acatactgga accatcgtac agggggctcc tccatgcttt ttctactatt taccaacagg 541 aagggttcct tgccctttat cgaggggttt ccctcactgt tgtaggtgct ctcccgttct 601 ctgctggctc ccttcttgtt tacatgaacc tggagaaaat ctggaacgga ccccgagatc 661 agttctctct cccacagaac tttgctaatg tctgtctggc tgctgcagtg acccagaccc 721 tctcctttcc ctttgagacc gtgaagagaa agatgcagcc cacagaacaa gaagaacccc 781 acagcagcca ttctttgcca tcatcttggc caggaaccca gcatccagaa tgtagacttg 841 agaccctggc tccttccact aggacattta tttcctaatg tttcaatcac ctcatcccag 901 cttctgtttc c //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
SNP
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on