Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_054325653.1
FASTA Graphics
LOCUS XM_054325653 1715 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens neutrophil cytosolic factor 4 (NCF4), transcript variant X4, mRNA. ACCESSION XM_054325653 VERSION XM_054325653.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060946) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1715 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="22" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..1715 /gene="NCF4" /gene_synonym="CGD3; NCF; P40PHOX; SH3PXD4" /note="neutrophil cytosolic factor 4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 1 long SRA read, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:4689" /db_xref="HGNC:HGNC:7662" /db_xref="MIM:601488" CDS 503..1693 /gene="NCF4" /gene_synonym="CGD3; NCF; P40PHOX; SH3PXD4" /codon_start=1 /product="neutrophil cytosol factor 4 isoform X4" /protein_id="XP_054181628.1" /db_xref="GeneID:4689" /db_xref="HGNC:HGNC:7662" /db_xref="MIM:601488" /translation="MLIYYFFLNVGSPMRSKLHEAVSVLIAAVSLEDDGSGRVLSSTE HLLYAGLCSGHWDVGDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYL IYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAY MKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRM AAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILK DFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAFLPSLRPPPLTSPSHGSLSHSK APSGSQMSHNAVTSHQRPGWPGQPHSPFPHPTPHFQPDASLLQPVTPLGTSRWRKISA ALPY" ORIGIN 1 tgtggccgcc cccgggcctt ctcactgctc ctcataggcc ttagggacaa aggccagtcc 61 ttctgcagtc cctgatcaac atgagaggct ggggttgagt cagaacccaa atactcagaa 121 atgcaacctc tcagaactgc tttaacgaaa ctttgagctg tggctcacca ccctcagaca 181 caaatgagaa cactgaggct ccaagagtgg gagtgacttg cccacggtca cacaacgagt 241 gaccggcagt gtctggagag gaatgcaggt gtcctgggtc ccaggctggg gccctttgct 301 tcacatggtg atcagcaatg actttccatc ttctgcgcaa acagaattca cagaatctgg 361 cttgttcttc cgctaatcag ggcttgcctc aaatgtcacc tcctccaaga agccttcctg 421 acagccccta cctcattgct gtctgaccct ttgccctatt tcccttttct gcctggttct 481 tatattacag gaataatatt atatgctcat ttattatttt ttcttgaacg ttggctcccc 541 catgagaagc aagctccacg aggctgtgtc cgttttgatc gctgctgtat cactagaaga 601 cgacggtagt ggccgtgtat tgagcagtac tgagcaccta ctgtatgccg ggctctgttc 661 tgggcactgg gatgtaggtg actttgaaca gcttccggat gatgttgcca tctcggccaa 721 cattgctgac atcgaggaga agagaggctt caccagccac tttgttttcg tcatcgaggt 781 gaagacaaaa ggaggatcca agtacctcat ctaccgccgc taccgccagt tccatgcttt 841 gcagagcaag ctggaggagc gcttcgggcc agacagcaag agcagtgccc tggcctgtac 901 cctgcccaca ctcccagcca aagtctacgt gggtgtgaaa caggagatcg ccgagatgcg 961 gatacctgcc ctcaacgcct acatgaagag cctgctcagc ctgccggtct gggtgctgat 1021 ggatgaggac gtccggatct tcttttacca gtcgccctat gactcagagc aggtgcccca 1081 ggcactccgc cggctccgcc cgcgcacccg gaaagtcaag agcgtgtccc cacagggcaa 1141 cagcgttgac cgcatggcag ctccgagagc agaggctcta tttgacttca ctggaaacag 1201 caaactggag ctgaatttca aagctggaga tgtgatcttc ctcctcagtc ggatcaacaa 1261 agactggctg gagggcactg tccggggagc cacgggcatc ttccctctct ccttcgtgaa 1321 gatcctcaaa gacttccctg aggaggacga ccccaccaac tggctgcgtt gctactacta 1381 cgaagacacc atcagcacca tcaagtctgt ggcctgggag ggaggggcct gtccagcctt 1441 cctgccatcc ctacgaccac cgcccctcac atcaccttct catgggtccc tctcccactc 1501 caaagccccc agtggctccc agatgagcca caatgctgta acaagccatc aacgtccagg 1561 gtggcctggc cagcctcatt cccctttccc ccaccccaca ccccacttcc agcctgatgc 1621 ctccttactc cagcctgtca cccccttagg gacatcgcgg tggaggaaga tctcagcagc 1681 actcccctat tgaaagacct gctggagctc acaag //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
SNP
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on