Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_054332097.1
FASTA Graphics
LOCUS XM_054332097 1936 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens envoplakin like (EVPLL), transcript variant X6, mRNA. ACCESSION XM_054332097 VERSION XM_054332097.1 DBLINK BioProject: PRJNA168 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_017363819.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_000001405.40-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1936 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17p11.2" gene 1..1936 /gene="EVPLL" /note="envoplakin like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 ESTs, 1 long SRA read, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns" /db_xref="GeneID:645027" /db_xref="HGNC:HGNC:35236" CDS 482..1105 /gene="EVPLL" /codon_start=1 /product="envoplakin-like protein isoform X6" /protein_id="XP_054188072.1" /db_xref="GeneID:645027" /db_xref="HGNC:HGNC:35236" /translation="MVLPPRRGIQGRLGTRAGAETEAGLRRPVWAGHGGAGGTDRGAQ HRAEGDQRPRRAAAEPGGAGCRHHPEPIPRPTEGGVVARAEPGQPVHALQGCTWQLSA LAEQQRRILQQDWSDLMADPAGVRREYEHFKQHELLSQEQSVNQLEEDGKRMVELRHP AVGPIQAHQEALKMEWQNFLNLCICQETQLQHVEDYSRILCPSSSPH" ORIGIN 1 gccagactta gctgaccagc cagcaaggac gcccgctgcc tcccacctgc cctcctgccc 61 tccttcacca gccaagccca gcctgagcca gcacctgcct ttatgaccat gttcaaggga 121 ctgagcaaag gctcccaggg gaaggggtcc cccaaggact ccccagccaa ggggtccccc 181 aaaggctccc ccagcaagca cagctgccag cgccgaccag gtggagcggg acatcctgga 241 gacgcagaag aggctgcagc aggaccggct gaacagtgag cagagccagg ccctgcagca 301 ccagcaggag acgggcagca gcctgaagga ggccgaggtg ctgctcaagg acctcttcct 361 ggacgtggac aaggcccggc ggctcaagca cccgcaggct gaggagactg agaaggacat 421 cgagcagctg cacgagcggg tgacccagga gtgtgcggag tactgtgccc tgtacgagaa 481 gatggtgctg ccgccccgac gtgggatcca aggtcgactg ggcacacgtg ctggagcaga 541 aacagaagct ggtctgcgca ggccagtatg ggccgggcat ggcggagctg gaggaacaga 601 tcgcggagct caacatcgtg cagaaggaga tcaacgacca aggagagcag ctgcggagcc 661 tggtggggcc ggatgccgcc accatccgga gccaataccg agacctactg agggcggcgt 721 cgtggcgcgg gcagagcctg ggcagcctgt acacgcactg cagggctgca cgtggcagct 781 gagcgccctg gcggagcagc agcgccgcat cctgcagcag gactggagcg acctcatggc 841 cgaccctgcg ggcgtgcggc gggaatacga gcacttcaag cagcacgagc tgctgagcca 901 ggagcagagc gtaaaccagc tggaggagga cggcaagcgc atggtggagc tgcggcaccc 961 cgcggtgggg cccatccagg cccaccagga ggccctgaag atggagtggc agaacttcct 1021 gaacctgtgc atctgccagg agacccagct ccagcacgtg gaggactaca gccggattct 1081 gtgtccatct tcctctcctc attgactctg catgaagggg atttctggtg gagtaagggt 1141 agcagctctt gccgcacgtg cagagagaga ggaacttcca gtgcccgcta tggagccaca 1201 gcccacagca tggggaagtc cccatccaga ggcagtgctg cagctagagg tagctccaga 1261 gtcctccggg ccctgcaccg atacagccaa agaccagcaa agcgacaagc tgccagacct 1321 catgccacct gctgtagcca ctgggctcag ccctggagct gagagcatcg ctggagatag 1381 acgtggcaga gaagaggttg cgagcatggc cccagccagc agctcccacg ctgcccctag 1441 tcctgggcat ggagcgagcc ttggtgtcag agaccagggt gtgcagtctg agctcctcta 1501 ccttactaaa gagaggcctc ttttatttac cagagccaca gccctgctgc ctcaggacct 1561 tttcattctg ccggtgctgg ggctgtctat ctgcaagctg gaggtgttga gagcaggaaa 1621 aggaggctgt gaggaagggt tcgggcagct cctcctgctc tcagaggtgg cctcctcctc 1681 caggcatgga ggtctgtcca ctactgggct tctgggctat ttgcccctga tttgctccct 1741 ggtacgggct cttcttaaca ggcaggcaag gggtgcgggg accaggtgag ggcttcaaag 1801 ggtacagtac caaatcttcc aaactcagca cttgtgccct ggggtctcca aactgtcttc 1861 tgccctagaa tttattcata ctgttaaatt accagtttat gcaaatgata tgtaaataaa 1921 gctcaatttt ttgaaa //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
SNP
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on