LOCUS NM_011617 842 bp mRNA linear ROD 05-AUG-2024
DEFINITION Mus musculus CD70 antigen (Cd70), mRNA.
ACCESSION NM_011617
VERSION NM_011617.2
KEYWORDS RefSeq; RefSeq Select.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 842)
AUTHORS Englebert,K., Taquin,A., Azouz,A., Acolty,V., Vande Velde,S.,
Vanhollebeke,M., Innes,H., Boon,L., Keler,T., Leo,O., Goriely,S.,
Moser,M. and Oldenhove,G.
TITLE The CD27/CD70 pathway negatively regulates visceral adipose
tissue-resident Th2 cells and controls metabolic homeostasis
JOURNAL Cell Rep 43 (3), 113824 (2024)
PUBMED 38386557
REMARK GeneRIF: The CD27/CD70 pathway negatively regulates visceral
adipose tissue-resident Th2 cells and controls metabolic
homeostasis.
REFERENCE 2 (bases 1 to 842)
AUTHORS Zhao,Y., Caron,C., Chan,Y.Y., Lee,C.K., Xu,X., Zhang,J.,
Masubuchi,T., Wu,C., Bui,J.D. and Hui,E.
TITLE cis-B7:CD28 interactions at invaginated synaptic membranes provide
CD28 co-stimulation and promote CD8+ T cell function and anti-tumor
immunity
JOURNAL Immunity 56 (6), 1187-1203 (2023)
PUBMED 37160118
REMARK GeneRIF: cis-B7:CD28 interactions at invaginated synaptic membranes
provide CD28 co-stimulation and promote CD8[+] T cell function and
anti-tumor immunity.
REFERENCE 3 (bases 1 to 842)
AUTHORS Gong,L., Luo,J., Zhang,Y., Yang,Y., Li,S., Fang,X., Zhang,B.,
Huang,J., Chow,L.K., Chung,D., Huang,J., Huang,C., Liu,Q., Bai,L.,
Tiu,Y.C., Wu,P., Wang,Y., Tsao,G.S., Kwong,D.L., Lee,A.W., Dai,W.
and Guan,X.Y.
TITLE Nasopharyngeal carcinoma cells promote regulatory T cell
development and suppressive activity via CD70-CD27 interaction
JOURNAL Nat Commun 14 (1), 1912 (2023)
PUBMED 37024479
REMARK GeneRIF: Nasopharyngeal carcinoma cells promote regulatory T cell
development and suppressive activity via CD70-CD27 interaction.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 842)
AUTHORS Wu,R., Ohara,R.A., Jo,S., Liu,T.T., Ferris,S.T., Ou,F., Kim,S.,
Theisen,D.J., Anderson,D.A. 3rd, Wong,B.W., Gershon,T.,
Schreiber,R.D., Murphy,T.L. and Murphy,K.M.
TITLE Mechanisms of CD40-dependent cDC1 licensing beyond costimulation
JOURNAL Nat Immunol 23 (11), 1536-1550 (2022)
PUBMED 36271147
REFERENCE 5 (bases 1 to 842)
AUTHORS Vogel,I., Acolty,V., Keler,T., Goriely,S., Leo,O. and Moser,M.
TITLE Agonistic anti-CD27 antibody ameliorates EAE by suppressing IL-17
production
JOURNAL Eur J Immunol 52 (10), 1620-1629 (2022)
PUBMED 35856659
REFERENCE 6 (bases 1 to 842)
AUTHORS Xie,S., Chang,S., Yang,P., Jacob,C., Kaliyaperumal,A., Datta,S.K.
and Mohan,C.
TITLE Genetic contributions of nonautoimmune SWR mice toward lupus
nephritis
JOURNAL J Immunol 167 (12), 7141-7149 (2001)
PUBMED 11739537
REFERENCE 7 (bases 1 to 842)
AUTHORS Arens,R., Tesselaar,K., Baars,P.A., van Schijndel,G.M.,
Hendriks,J., Pals,S.T., Krimpenfort,P., Borst,J., van Oers,M.H. and
van Lier,R.A.
TITLE Constitutive CD27/CD70 interaction induces expansion of
effector-type T cells and results in IFNgamma-mediated B cell
depletion
JOURNAL Immunity 15 (5), 801-812 (2001)
PUBMED 11728341
REFERENCE 8 (bases 1 to 842)
AUTHORS Locksley,R.M., Killeen,N. and Lenardo,M.J.
TITLE The TNF and TNF receptor superfamilies: integrating mammalian
biology
JOURNAL Cell 104 (4), 487-501 (2001)
PUBMED 11239407
REMARK Review article
REFERENCE 9 (bases 1 to 842)
AUTHORS Oshima,H., Nakano,H., Nohara,C., Kobata,T., Nakajima,A.,
Jenkins,N.A., Gilbert,D.J., Copeland,N.G., Muto,T., Yagita,H. and
Okumura,K.
TITLE Characterization of murine CD70 by molecular cloning and mAb
JOURNAL Int Immunol 10 (4), 517-526 (1998)
PUBMED 9620608
REFERENCE 10 (bases 1 to 842)
AUTHORS Tesselaar,K., Gravestein,L.A., van Schijndel,G.M., Borst,J. and van
Lier,R.A.
TITLE Characterization of murine CD70, the ligand of the TNF receptor
family member CD27
JOURNAL J Immunol 159 (10), 4959-4965 (1997)
PUBMED 9366422
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from CT025692.15.
On Mar 21, 2007 this sequence version replaced NM_011617.1.
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: Y13636.1, U78091.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN00849375, SAMN00849383
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-344 CT025692.15 32639-32982 c
345-378 CT025692.15 31972-32005 c
379-842 CT025692.15 29202-29665 c
FEATURES Location/Qualifiers
source 1..842
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="17"
/map="17 29.69 cM"
gene 1..842
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/note="CD70 antigen"
/db_xref="GeneID:21948"
/db_xref="MGI:MGI:1195273"
exon 1..344
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/inference="alignment:Splign:2.1.0"
misc_feature 126..128
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/note="upstream in-frame stop codon"
CDS 177..764
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/note="CD27-L; CD27 ligand; tumor necrosis factor ligand
superfamily member 7; Ki-24 antigen; tumor necrosis factor
ligand 8a"
/codon_start=1
/product="CD70 antigen"
/protein_id="NP_035747.1"
/db_xref="CCDS:CCDS28927.1"
/db_xref="GeneID:21948"
/db_xref="MGI:MGI:1195273"
/translation="MPEEGRPCPWVRWSGTAFQRQWPWLLLVVFITVFCCWFHCSGLL
SKQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQ
DGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRL
TYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP"
misc_feature 246..308
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/note="propagated from UniProtKB/Swiss-Prot (O55237.1);
transmembrane region"
misc_feature 369..371
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (O55237.1); glycosylation site"
misc_feature 522..524
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (O55237.1); glycosylation site"
misc_feature 690..692
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (O55237.1); glycosylation site"
exon 345..378
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/inference="alignment:Splign:2.1.0"
exon 379..842
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/inference="alignment:Splign:2.1.0"
regulatory 820..825
/regulatory_class="polyA_signal_sequence"
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/note="hexamer: TATAAA"
polyA_site 842
/gene="Cd70"
/gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
/note="major polyA site"
ORIGIN
1 gaaggtgcca aaagctccag gggatttccc tgccctccga gaagaggccc agttcttccc
61 ctgcatcgga catccccgag gttctaaggg caggtcaagg caggcagaag cttcaaaagc
121 tcggctgagg aggctacagc ttcccgctgc cttcaggccg ctgcttccgt gcagggatgc
181 cggaggaagg tcgcccttgc ccctgggttc gctggagcgg gaccgcgttc cagcgccaat
241 ggccatggct gctgctggtg gtgtttatta ctgtgttttg ctgttggttt cattgtagcg
301 gactactcag taagcagcaa cagaggctgc tggagcaccc tgagccgcac acagctgagt
361 tacagctgaa tctcacagtt cctcggaagg accccacact gcgctgggga gcaggcccag
421 ccttgggaag gtccttcaca cacggaccag agctggagga gggccatctg cgtatccatc
481 aagatggcct ctacaggctg catatccagg tgacactggc caactgctct tccccaggca
541 gcaccctgca gcacagggcc accctggctg tgggcatctg ctcccccgct gcgcacggca
601 tcagcttgct gcgtgggcgc tttggacagg actgtacagt ggcattacag cgcctgacat
661 acctggtcca cggagatgtc ctctgtacca acctcaccct gcctctgctg ccgtcccgca
721 acgctgatga gaccttcttt ggagttcagt ggatatgccc ttgaccacaa ctccaggatg
781 acttgtgaat attttttttc ttttcaagtt ctacgtattt ataaatgtat atagtacaca
841 ta
//