U.S. flag

An official website of the United States government

Mus musculus CD70 antigen (Cd70), mRNA

NCBI Reference Sequence: NM_011617.2

FASTA Graphics 

LOCUS       NM_011617                842 bp    mRNA    linear   ROD 05-AUG-2024
DEFINITION  Mus musculus CD70 antigen (Cd70), mRNA.
ACCESSION   NM_011617
VERSION     NM_011617.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 842)
  AUTHORS   Englebert,K., Taquin,A., Azouz,A., Acolty,V., Vande Velde,S.,
            Vanhollebeke,M., Innes,H., Boon,L., Keler,T., Leo,O., Goriely,S.,
            Moser,M. and Oldenhove,G.
  TITLE     The CD27/CD70 pathway negatively regulates visceral adipose
            tissue-resident Th2 cells and controls metabolic homeostasis
  JOURNAL   Cell Rep 43 (3), 113824 (2024)
   PUBMED   38386557
  REMARK    GeneRIF: The CD27/CD70 pathway negatively regulates visceral
            adipose tissue-resident Th2 cells and controls metabolic
            homeostasis.
REFERENCE   2  (bases 1 to 842)
  AUTHORS   Zhao,Y., Caron,C., Chan,Y.Y., Lee,C.K., Xu,X., Zhang,J.,
            Masubuchi,T., Wu,C., Bui,J.D. and Hui,E.
  TITLE     cis-B7:CD28 interactions at invaginated synaptic membranes provide
            CD28 co-stimulation and promote CD8+ T cell function and anti-tumor
            immunity
  JOURNAL   Immunity 56 (6), 1187-1203 (2023)
   PUBMED   37160118
  REMARK    GeneRIF: cis-B7:CD28 interactions at invaginated synaptic membranes
            provide CD28 co-stimulation and promote CD8[+] T cell function and
            anti-tumor immunity.
REFERENCE   3  (bases 1 to 842)
  AUTHORS   Gong,L., Luo,J., Zhang,Y., Yang,Y., Li,S., Fang,X., Zhang,B.,
            Huang,J., Chow,L.K., Chung,D., Huang,J., Huang,C., Liu,Q., Bai,L.,
            Tiu,Y.C., Wu,P., Wang,Y., Tsao,G.S., Kwong,D.L., Lee,A.W., Dai,W.
            and Guan,X.Y.
  TITLE     Nasopharyngeal carcinoma cells promote regulatory T cell
            development and suppressive activity via CD70-CD27 interaction
  JOURNAL   Nat Commun 14 (1), 1912 (2023)
   PUBMED   37024479
  REMARK    GeneRIF: Nasopharyngeal carcinoma cells promote regulatory T cell
            development and suppressive activity via CD70-CD27 interaction.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 842)
  AUTHORS   Wu,R., Ohara,R.A., Jo,S., Liu,T.T., Ferris,S.T., Ou,F., Kim,S.,
            Theisen,D.J., Anderson,D.A. 3rd, Wong,B.W., Gershon,T.,
            Schreiber,R.D., Murphy,T.L. and Murphy,K.M.
  TITLE     Mechanisms of CD40-dependent cDC1 licensing beyond costimulation
  JOURNAL   Nat Immunol 23 (11), 1536-1550 (2022)
   PUBMED   36271147
REFERENCE   5  (bases 1 to 842)
  AUTHORS   Vogel,I., Acolty,V., Keler,T., Goriely,S., Leo,O. and Moser,M.
  TITLE     Agonistic anti-CD27 antibody ameliorates EAE by suppressing IL-17
            production
  JOURNAL   Eur J Immunol 52 (10), 1620-1629 (2022)
   PUBMED   35856659
REFERENCE   6  (bases 1 to 842)
  AUTHORS   Xie,S., Chang,S., Yang,P., Jacob,C., Kaliyaperumal,A., Datta,S.K.
            and Mohan,C.
  TITLE     Genetic contributions of nonautoimmune SWR mice toward lupus
            nephritis
  JOURNAL   J Immunol 167 (12), 7141-7149 (2001)
   PUBMED   11739537
REFERENCE   7  (bases 1 to 842)
  AUTHORS   Arens,R., Tesselaar,K., Baars,P.A., van Schijndel,G.M.,
            Hendriks,J., Pals,S.T., Krimpenfort,P., Borst,J., van Oers,M.H. and
            van Lier,R.A.
  TITLE     Constitutive CD27/CD70 interaction induces expansion of
            effector-type T cells and results in IFNgamma-mediated B cell
            depletion
  JOURNAL   Immunity 15 (5), 801-812 (2001)
   PUBMED   11728341
REFERENCE   8  (bases 1 to 842)
  AUTHORS   Locksley,R.M., Killeen,N. and Lenardo,M.J.
  TITLE     The TNF and TNF receptor superfamilies: integrating mammalian
            biology
  JOURNAL   Cell 104 (4), 487-501 (2001)
   PUBMED   11239407
  REMARK    Review article
REFERENCE   9  (bases 1 to 842)
  AUTHORS   Oshima,H., Nakano,H., Nohara,C., Kobata,T., Nakajima,A.,
            Jenkins,N.A., Gilbert,D.J., Copeland,N.G., Muto,T., Yagita,H. and
            Okumura,K.
  TITLE     Characterization of murine CD70 by molecular cloning and mAb
  JOURNAL   Int Immunol 10 (4), 517-526 (1998)
   PUBMED   9620608
REFERENCE   10 (bases 1 to 842)
  AUTHORS   Tesselaar,K., Gravestein,L.A., van Schijndel,G.M., Borst,J. and van
            Lier,R.A.
  TITLE     Characterization of murine CD70, the ligand of the TNF receptor
            family member CD27
  JOURNAL   J Immunol 159 (10), 4959-4965 (1997)
   PUBMED   9366422
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CT025692.15.
            
            On Mar 21, 2007 this sequence version replaced NM_011617.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: Y13636.1, U78091.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849375, SAMN00849383
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-344               CT025692.15        32639-32982         c
            345-378             CT025692.15        31972-32005         c
            379-842             CT025692.15        29202-29665         c
FEATURES             Location/Qualifiers
     source          1..842
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="17"
                     /map="17 29.69 cM"
     gene            1..842
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /note="CD70 antigen"
                     /db_xref="GeneID:21948"
                     /db_xref="MGI:MGI:1195273"
     exon            1..344
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    126..128
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /note="upstream in-frame stop codon"
     CDS             177..764
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /note="CD27-L; CD27 ligand; tumor necrosis factor ligand
                     superfamily member 7; Ki-24 antigen; tumor necrosis factor
                     ligand 8a"
                     /codon_start=1
                     /product="CD70 antigen"
                     /protein_id="NP_035747.1"
                     /db_xref="CCDS:CCDS28927.1"
                     /db_xref="GeneID:21948"
                     /db_xref="MGI:MGI:1195273"
                     /translation="MPEEGRPCPWVRWSGTAFQRQWPWLLLVVFITVFCCWFHCSGLL
                     SKQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQ
                     DGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRL
                     TYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP"
     misc_feature    246..308
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /note="propagated from UniProtKB/Swiss-Prot (O55237.1);
                     transmembrane region"
     misc_feature    369..371
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (O55237.1); glycosylation site"
     misc_feature    522..524
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (O55237.1); glycosylation site"
     misc_feature    690..692
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (O55237.1); glycosylation site"
     exon            345..378
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /inference="alignment:Splign:2.1.0"
     exon            379..842
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /inference="alignment:Splign:2.1.0"
     regulatory      820..825
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /note="hexamer: TATAAA"
     polyA_site      842
                     /gene="Cd70"
                     /gene_synonym="Cd27l; CD27LG; Tnfsf7; Tnlg8a"
                     /note="major polyA site"
ORIGIN      
        1 gaaggtgcca aaagctccag gggatttccc tgccctccga gaagaggccc agttcttccc
       61 ctgcatcgga catccccgag gttctaaggg caggtcaagg caggcagaag cttcaaaagc
      121 tcggctgagg aggctacagc ttcccgctgc cttcaggccg ctgcttccgt gcagggatgc
      181 cggaggaagg tcgcccttgc ccctgggttc gctggagcgg gaccgcgttc cagcgccaat
      241 ggccatggct gctgctggtg gtgtttatta ctgtgttttg ctgttggttt cattgtagcg
      301 gactactcag taagcagcaa cagaggctgc tggagcaccc tgagccgcac acagctgagt
      361 tacagctgaa tctcacagtt cctcggaagg accccacact gcgctgggga gcaggcccag
      421 ccttgggaag gtccttcaca cacggaccag agctggagga gggccatctg cgtatccatc
      481 aagatggcct ctacaggctg catatccagg tgacactggc caactgctct tccccaggca
      541 gcaccctgca gcacagggcc accctggctg tgggcatctg ctcccccgct gcgcacggca
      601 tcagcttgct gcgtgggcgc tttggacagg actgtacagt ggcattacag cgcctgacat
      661 acctggtcca cggagatgtc ctctgtacca acctcaccct gcctctgctg ccgtcccgca
      721 acgctgatga gaccttcttt ggagttcagt ggatatgccc ttgaccacaa ctccaggatg
      781 acttgtgaat attttttttc ttttcaagtt ctacgtattt ataaatgtat atagtacaca
      841 ta
//
Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Reference sequence information

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.