LOCUS NM_002479 1576 bp mRNA linear PRI 25-JUN-2018
DEFINITION Homo sapiens myogenin (MYOG), mRNA.
ACCESSION NM_002479
VERSION NM_002479.5
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1576)
AUTHORS Lee SW, Won JY, Yang J, Lee J, Kim SY, Lee EJ and Kim HS.
TITLE AKAP6 inhibition impairs myoblast differentiation and muscle
regeneration: Positive loop between AKAP6 and myogenin
JOURNAL Sci Rep 5, 16523 (2015)
PUBMED 26563778
REMARK GeneRIF: Findings indicate a interplay between A-kinase anchoring
protein 6 (AKAP6) and myogenin.
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 1576)
AUTHORS Sahni N, Yi S, Taipale M, Fuxman Bass JI, Coulombe-Huntington J,
Yang F, Peng J, Weile J, Karras GI, Wang Y, Kovacs IA, Kamburov A,
Krykbaeva I, Lam MH, Tucker G, Khurana V, Sharma A, Liu YY, Yachie
N, Zhong Q, Shen Y, Palagi A, San-Miguel A, Fan C, Balcha D, Dricot
A, Jordan DM, Walsh JM, Shah AA, Yang X, Stoyanova AK, Leighton A,
Calderwood MA, Jacob Y, Cusick ME, Salehi-Ashtiani K, Whitesell LJ,
Sunyaev S, Berger B, Barabasi AL, Charloteaux B, Hill DE, Hao T,
Roth FP, Xia Y, Walhout AJM, Lindquist S and Vidal M.
TITLE Widespread macromolecular interaction perturbations in human
genetic disorders
JOURNAL Cell 161 (3), 647-660 (2015)
PUBMED 25910212
REFERENCE 3 (bases 1 to 1576)
AUTHORS Park SY, Yun Y, Kim MJ and Kim IS.
TITLE Myogenin is a positive regulator of MEGF10 expression in skeletal
muscle
JOURNAL Biochem. Biophys. Res. Commun. 450 (4), 1631-1637 (2014)
PUBMED 25044114
REMARK GeneRIF: results indicate that myogenin is a positive regulator in
transcriptional regulation of MEGF10 in skeletal muscle
REFERENCE 4 (bases 1 to 1576)
AUTHORS Snijders T, Wall BT, Dirks ML, Senden JM, Hartgens F, Dolmans J,
Losen M, Verdijk LB and van Loon LJ.
TITLE Muscle disuse atrophy is not accompanied by changes in skeletal
muscle satellite cell content
JOURNAL Clin. Sci. 126 (8), 557-566 (2014)
PUBMED 24215591
REMARK GeneRIF: Data indicate that muscle MYOG mRNA expression doubled,
whereas MSTN protein expression decreased following immobilization.
REFERENCE 5 (bases 1 to 1576)
AUTHORS Dionyssiou MG, Ehyai S, Avrutin E, Connor MK and McDermott JC.
TITLE Glycogen synthase kinase 3beta represses MYOGENIN function in
alveolar rhabdomyosarcoma
JOURNAL Cell Death Dis 5, e1094 (2014)
PUBMED 24577092
REMARK GeneRIF: Sustained GSK3beta activity represses a critical
regulatory step in the myogenic cascade, contributing to the
undifferentiated, proliferative phenotype in alveolar
rhabdomyosarcoma.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1576)
AUTHORS Funk WD and Wright WE.
TITLE Cyclic amplification and selection of targets for multicomponent
complexes: myogenin interacts with factors recognizing binding
sites for basic helix-loop-helix, nuclear factor 1,
myocyte-specific enhancer-binding factor 2, and COMP1 factor
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 89 (20), 9484-9488 (1992)
PUBMED 1329097
REFERENCE 7 (bases 1 to 1576)
AUTHORS Chakraborty T, Martin JF and Olson EN.
TITLE Analysis of the oligomerization of myogenin and E2A products in
vivo using a two-hybrid assay system
JOURNAL J. Biol. Chem. 267 (25), 17498-17501 (1992)
PUBMED 1325437
REFERENCE 8 (bases 1 to 1576)
AUTHORS Salminen A, Braun T, Buchberger A, Jurs S, Winter B and Arnold HH.
TITLE Transcription of the muscle regulatory gene Myf4 is regulated by
serum components, peptide growth factors and signaling pathways
involving G proteins
JOURNAL J. Cell Biol. 115 (4), 905-917 (1991)
PUBMED 1659574
REFERENCE 9 (bases 1 to 1576)
AUTHORS Lassar AB, Davis RL, Wright WE, Kadesch T, Murre C, Voronova A,
Baltimore D and Weintraub H.
TITLE Functional activity of myogenic HLH proteins requires
hetero-oligomerization with E12/E47-like proteins in vivo
JOURNAL Cell 66 (2), 305-315 (1991)
PUBMED 1649701
REFERENCE 10 (bases 1 to 1576)
AUTHORS Weintraub H, Davis R, Tapscott S, Thayer M, Krause M, Benezra R,
Blackwell TK, Turner D, Rupp R, Hollenberg S et al.
TITLE The myoD gene family: nodal point during specification of the
muscle cell lineage
JOURNAL Science 251 (4995), 761-766 (1991)
PUBMED 1846704
REMARK Review article
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BC053899.1 and AC105940.2.
[WARNING] On Nov 24, 2018 this sequence was replaced by
NM_002479.6.
On Aug 10, 2012 this sequence version replaced NM_002479.4.
Summary: Myogenin is a muscle-specific transcription factor that
can induce myogenesis in a variety of cell types in tissue culture.
It is a member of a large family of proteins related by sequence
homology, the helix-loop-helix (HLH) proteins. It is essential for
the development of functional skeletal muscle. [provided by RefSeq,
Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC053899.1, ERR279849.7471.1
[ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA2158800, SAMEA2162946
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
CDS uses downstream in-frame AUG :: lack of evidence for use of
upstream AUG
##RefSeq-Attributes-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-65 BC053899.1 1-65
66-66 AC105940.2 27334-27334 c
67-1429 BC053899.1 67-1429
1430-1479 AC105940.2 24544-24593 c
1480-1576 BC053899.1 1477-1573
FEATURES Location/Qualifiers
source 1..1576
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q32.1"
gene 1..1576
/gene="MYOG"
/gene_synonym="bHLHc3; myf-4; MYF4"
/note="myogenin"
/db_xref="GeneID:4656"
/db_xref="HGNC:HGNC:7612"
/db_xref="MIM:159980"
exon 1..548
/gene="MYOG"
/gene_synonym="bHLHc3; myf-4; MYF4"
/inference="alignment:Splign:2.1.0"
misc_feature 28
/gene="MYOG"
/gene_synonym="bHLHc3; myf-4; MYF4"
/note="transcription start site (PMID:1659574)"
CDS 78..752
/gene="MYOG"
/gene_synonym="bHLHc3; myf-4; MYF4"
/note="myogenic factor 4; class C basic helix-loop-helix
protein 3"
/codon_start=1
/product="myogenin"
/protein_id="NP_002470.2"
/db_xref="CCDS:CCDS1433.1"
/db_xref="GeneID:4656"
/db_xref="HGNC:HGNC:7612"
/db_xref="MIM:159980"
/translation="MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSP
EAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFE
ALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPS
ECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFP
DETMPN"
misc_feature 306..308
/gene="MYOG"
/gene_synonym="bHLHc3; myf-4; MYF4"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by CaMK2G.
{ECO:0000250|UniProtKB:P20428}; propagated from
UniProtKB/Swiss-Prot (P15173.2); phosphorylation site"
misc_feature 312..314
/gene="MYOG"
/gene_synonym="bHLHc3; myf-4; MYF4"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by CaMK2G.
{ECO:0000250|UniProtKB:P20428}; propagated from
UniProtKB/Swiss-Prot (P15173.2); phosphorylation site"
misc_feature 336..338
/gene="MYOG"
/gene_synonym="bHLHc3; myf-4; MYF4"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by CaMK2G.
{ECO:0000250|UniProtKB:P20428}; propagated from
UniProtKB/Swiss-Prot (P15173.2); phosphorylation site"
exon 549..630
/gene="MYOG"
/gene_synonym="bHLHc3; myf-4; MYF4"
/inference="alignment:Splign:2.1.0"
exon 631..1533
/gene="MYOG"
/gene_synonym="bHLHc3; myf-4; MYF4"
/inference="alignment:Splign:2.1.0"
regulatory 1513..1518
/regulatory_class="polyA_signal_sequence"
/gene="MYOG"
/gene_synonym="bHLHc3; myf-4; MYF4"
polyA_site 1533
/gene="MYOG"
/gene_synonym="bHLHc3; myf-4; MYF4"
ORIGIN
1 aaatggcacc cagcagttgg cgtgaggggc tgctggagct tgggggctgg tggcaggaac
61 aagccttttc cgaccccatg gagctgtatg agacatcccc ctacttctac caggaacccc
121 gcttctatga tggggaaaac tacctgcctg tccacctcca gggcttcgaa ccaccaggct
181 acgagcggac ggagctcacc ctgagccccg aggccccagg gccccttgag gacaaggggc
241 tggggacccc cgagcactgt ccaggccagt gcctgccgtg ggcgtgtaag gtgtgtaaga
301 ggaagtcggt gtccgtggac cggcggcggg cggccacact gagggagaag cgcaggctca
361 agaaggtgaa tgaggccttc gaggccctga agagaagcac cctgctcaac cccaaccagc
421 ggctgcccaa ggtggagatc ctgcgcagtg ccatccagta catcgagcgc ctccaggccc
481 tgctcagctc cctcaaccag gaggagcgtg acctccgcta ccggggcggg ggcgggcccc
541 agccaggggt gcccagcgaa tgcagctctc acagcgcctc ctgcagtcca gagtggggca
601 gtgcactgga gttcagcgcc aacccagggg atcatctgct cacggctgac cctacagatg
661 cccacaacct gcactccctc acctccatcg tggacagcat cacagtggaa gatgtgtctg
721 tggccttccc agatgaaacc atgcccaact gagattgtct tccaagccgg gcatccttgc
781 gagcccccca agctggccac agatgccact acttctgtag caggggcctc ctaagccagg
841 ctgccctgat gctaggaagc cagctctggg gtgccatagg ccagactatc cccttcctca
901 tccatgtaag gttaacccac cccccagcaa gggactggac gccctcattc agctgcctcc
961 ttagaggaga gggcatcccc tttccaggga ggtaaagcag gggaccagag cgccccctcg
1021 tgtatgcccc agctcagggg gcaaactcag gagcttcctt tttatcataa cgcggcctct
1081 aattccaccc cccaagtgaa acggtttgag agacgcagtg ccctgacctg gacaagctgt
1141 gcacgtctcc tgttctggtc tcttcccgat gccagtggct gggctgggcc tgccctgaat
1201 tgagagagaa gaaggggaga ggaacagccc tctgttccca agtccctggg gggccaaact
1261 tttgcagtga atattgggaa ccttccagtg gttttatgtt ttgttttgtt tcgtgtgttg
1321 tttgtaaagc tgccatccga ccaaggtctc ctgtgctgaa gttgccgggg acaggcaggg
1381 aaaaggggtt ggggcctctt gggggtgatt tcttttgtta acaaagcatt gtgtggtttt
1441 gccattgttt tgtatttttt tttttttttt ttttttttgc taacttattt ggatttcctt
1501 ttttaaaaaa tgaataaaga ctggttgcca gaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
1561 aaaaaaaaaa aaaaaa
//