U.S. flag

An official website of the United States government

TPA: ribosomal 60S subunit protein L14A [Saccharomyces cerevisiae S288C]

GenBank: DAA09151.1

GenPept Identical Proteins Graphics 

>DAA09151.1 TPA: ribosomal 60S subunit protein L14A [Saccharomyces cerevisiae S288C]
MSTDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAGVPRQAINLGQVVLTPLTF
ALPRGARTATVSKKWAAAAVCEKWAASSWAKKIAQRERRAALTDFERFQVMVLRKQKRYTVKKALAKA

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Reference sequence information

  • RefSeq protein
    See the reference protein sequence for ribosomal 60S subunit protein L14A (NP_012920.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.