U.S. flag

An official website of the United States government

RecName: Full=Metallothionein-2; Short=MT-2; AltName: Full=Metallothionein-2A; AltName: Full=Metallothionein-II; Short=MT-II

UniProtKB/Swiss-Prot: P02795.1

GenPept Identical Proteins Graphics 

>sp|P02795.1|MT2_HUMAN RecName: Full=Metallothionein-2; Short=MT-2; AltName: Full=Metallothionein-2A; AltName: Full=Metallothionein-II; Short=MT-II
MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Reference sequence information

  • RefSeq protein
    See the reference protein sequence for metallothionein-2 (NP_005944.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.