U.S. flag

An official website of the United States government

RecName: Full=Large ribosomal subunit protein eL14A; AltName: Full=60S ribosomal protein L14-A

UniProtKB/Swiss-Prot: P36105.1

GenPept Identical Proteins Graphics 

>sp|P36105.1|RL14A_YEAST RecName: Full=Large ribosomal subunit protein eL14A; AltName: Full=60S ribosomal protein L14-A
MSTDSIVKASNWRLVEVGRVVLIKKGQSAGKLAAIVEIIDQKKVLIDGPKAGVPRQAINLGQVVLTPLTF
ALPRGARTATVSKKWAAAAVCEKWAASSWAKKIAQRERRAALTDFERFQVMVLRKQKRYTVKKALAKA

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Protein 3D Structure

See all 37 structures...

Reference sequence information

  • RefSeq protein
    See the reference protein sequence for ribosomal 60S subunit protein L14A (NP_012920.1).

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.