U.S. flag

An official website of the United States government

DUF2778 domain-containing protein [Enterobacter hormaechei]

GenBank: QPO91622.1

GenPept Identical Proteins Graphics 

>QPO91622.1 DUF2778 domain-containing protein [Enterobacter hormaechei]
MGWKYEQSTGKMYKDGKLIETGYSGALTNKNNPDRQHVKGLGPLPRGTYKIAGHSNSKGPITIILEQTSG
ESFGRSEFRIHGDHKYGPAGFASEGCIILSLSTRRKILRDGGELEVVR

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Reference sequence information

  • RefSeq protein
    See the reference protein sequence for MULTISPECIES: tlde1 domain-containing protein (WP_006809708.1).

More about the gene I6L63_RS15230

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.