U.S. flag

An official website of the United States government

FeoB-associated Cys-rich membrane protein [Staphylococcus pseudintermedius]

GenBank: USH35895.1

GenPept Identical Proteins Graphics 

>USH35895.1 FeoB-associated Cys-rich membrane protein [Staphylococcus pseudintermedius]
MTLFINLLLIALILGYATWVMLSFFKKSKQGKCSACESSKGCPTESLPKHLK

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.