U.S. flag

An official website of the United States government

  • This record is a non-redundant protein sequence. Please read more here.

MULTISPECIES: ribosome-associated translation inhibitor RaiA [Enterobacter]

NCBI Reference Sequence: WP_014884866.1

GenPept Identical Proteins Graphics 

>WP_014884866.1 MULTISPECIES: ribosome-associated translation inhibitor RaiA [Enterobacter]
MTMNITSKQMEITPAIRQHVADRLAKLDKWQTHLINPHIILSKEPQGFIADATINTPNGHLVASAKHEDM
YTAINDLINKLERQLNKVQHKGEARRAASSVKDASFAEEVEEE

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Protein clusters for WP_014884866.1

More about the gene raiA

  • raiA gene
    Also Known As: LCD42_RS16655, LCD42_16...

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.