U.S. flag

An official website of the United States government

  • This record is a non-redundant protein sequence. Please read more here.

hypothetical protein [Stutzerimonas stutzeri]

NCBI Reference Sequence: WP_019342557.1

GenPept Identical Proteins Graphics 

>WP_019342557.1 hypothetical protein [Stutzerimonas stutzeri]
MHREYTRQYHQLRTHIERMLGSGAVIAERAPLTIRRGHQVYQVACGMLISEQSVR

Feature
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.