LOCUS NM_022189 1346 bp mRNA linear ROD 02-APR-2024
DEFINITION Rattus norvegicus 5-hydroxytryptamine receptor 3B (Htr3b), mRNA.
ACCESSION NM_022189
VERSION NM_022189.1
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 1346)
AUTHORS Enoch,M.A., Gorodetsky,E., Hodgkinson,C., Roy,A. and Goldman,D.
TITLE Functional genetic variants that increase synaptic serotonin and
5-HT3 receptor sensitivity predict alcohol and drug dependence
JOURNAL Mol Psychiatry 16 (11), 1139-1146 (2011)
PUBMED 20838391
REFERENCE 2 (bases 1 to 1346)
AUTHORS Ge,Q.F. and Zhang,H.Y.
TITLE [Effects of Chinese herbal medicines for regulating liver qi on
expression of 5-hydroxytryptamine 3B receptor in hypothalamic
tissues of rats with anger emotion]
JOURNAL Zhong Xi Yi Jie He Xue Bao 9 (8), 871-877 (2011)
PUBMED 21849148
REMARK GeneRIF: Chinese herbal medicines for regulating liver qi may treat
anger emotion in rats by improving the hypothalamic 5-HT3BR protein
and gene expression levels.
REFERENCE 3 (bases 1 to 1346)
AUTHORS Doucet,E., Latremoliere,A., Darmon,M., Hamon,M. and Emerit,M.B.
TITLE Immunolabelling of the 5-HT 3B receptor subunit in the central and
peripheral nervous systems in rodents
JOURNAL Eur J Neurosci 26 (2), 355-366 (2007)
PUBMED 17650111
REFERENCE 4 (bases 1 to 1346)
AUTHORS Yamada,K., Hattori,E., Iwayama,Y., Ohnishi,T., Ohba,H., Toyota,T.,
Takao,H., Minabe,Y., Nakatani,N., Higuchi,T., Detera-Wadleigh,S.D.
and Yoshikawa,T.
TITLE Distinguishable haplotype blocks in the HTR3A and HTR3B region in
the Japanese reveal evidence of association of HTR3B with female
major depression
JOURNAL Biol Psychiatry 60 (2), 192-201 (2006)
PUBMED 16487942
REFERENCE 5 (bases 1 to 1346)
AUTHORS Reeves,D.C. and Lummis,S.C.
TITLE Detection of human and rodent 5-HT3B receptor subunits by
anti-peptide polyclonal antibodies
JOURNAL BMC Neurosci 7, 27 (2006)
PUBMED 16571125
REMARK Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1346)
AUTHORS Morales,M. and Wang,S.D.
TITLE Differential composition of 5-hydroxytryptamine3 receptors
synthesized in the rat CNS and peripheral nervous system
JOURNAL J Neurosci 22 (15), 6732-6741 (2002)
PUBMED 12151552
REFERENCE 7 (bases 1 to 1346)
AUTHORS Hanna,M.C., Davies,P.A., Hales,T.G. and Kirkness,E.F.
TITLE Evidence for expression of heteromeric serotonin 5-HT(3) receptors
in rodents
JOURNAL J Neurochem 75 (1), 240-247 (2000)
PUBMED 10854267
REFERENCE 8 (bases 1 to 1346)
AUTHORS Davies,P.A., Pistis,M., Hanna,M.C., Peters,J.A., Lambert,J.J.,
Hales,T.G. and Kirkness,E.F.
TITLE The 5-HT3B subunit is a major determinant of serotonin-receptor
function
JOURNAL Nature 397 (6717), 359-363 (1999)
PUBMED 9950429
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from AF155044.1.
##Evidence-Data-START##
Transcript exon combination :: AF155044.1 [ECO:0000332]
RNAseq introns :: mixed sample support SAMD00132261,
SAMD00132271 [ECO:0006172]
##Evidence-Data-END##
##RefSeq-Attributes-START##
RefSeq Select criteria :: based on single protein-coding transcript
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..1346
/organism="Rattus norvegicus"
/mol_type="mRNA"
/strain="Sprague-Dawley"
/db_xref="taxon:10116"
/chromosome="8"
/map="8q23"
gene 1..1346
/gene="Htr3b"
/note="5-hydroxytryptamine receptor 3B"
/db_xref="GeneID:58963"
/db_xref="RGD:61820"
exon 1..72
/gene="Htr3b"
/inference="alignment:Splign:2.1.0"
misc_feature 21..23
/gene="Htr3b"
/note="upstream in-frame stop codon"
CDS 33..1346
/gene="Htr3b"
/note="serotonin-gated ion channel subunit; 5-HT3B;
5-HT-3B; serotonin receptor 3B; 5-HT3-B;
5-hydroxytryptamine (serotonin) receptor 3B, ionotropic"
/codon_start=1
/product="5-hydroxytryptamine receptor 3B precursor"
/protein_id="NP_071525.1"
/db_xref="GeneID:58963"
/db_xref="RGD:61820"
/translation="MILLWSCLLVAVVGILGTATPQPGNSSLHRLTRQLLQQYHKEVR
PVYNWAEATTVYLDLCVHAVLDVDVQNQKLKTSMWYREVWNDEFLSWNSSLFDDIQEI
SLPLSAIWAPDIIINEFVDVERSPDLPYVYVNSSGTIRNHKPIQVVSACSLQTYAFPF
DIQNCSLTFNSILHTVEDIDLGFLRNQEDIENDKRSFLNDSEWQLLSVTSTYHIRQSS
AGDFAQIRFNVVIRRCPLAYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTNVLVG
YTVFRVNMSDEVPRSAGCTSLIGVFFTVCMALLVLSLSKSILLIKFLYEERHSEQERP
LMCLRGDSDANESRLYLRAPCAEDTESPVRQEHQVPSDTLKDFWFQLQSINNSLRTRD
QVYQKEVEWLAILCHFDQLLFRIYLAVLGLYTVTLCSLWALWSRM"
sig_peptide 33..95
/gene="Htr3b"
/note="/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q9JJ16.1)"
mat_peptide 96..1343
/gene="Htr3b"
/product="5-hydroxytryptamine receptor 3B.
/id=PRO_0000312291"
/note="propagated from UniProtKB/Swiss-Prot (Q9JJ16.1)"
misc_feature 105..107
/gene="Htr3b"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q9JJ16.1); glycosylation site"
misc_feature 306..308
/gene="Htr3b"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q9JJ16.1); glycosylation site"
misc_feature 432..434
/gene="Htr3b"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q9JJ16.1); glycosylation site"
misc_feature 738..797
/gene="Htr3b"
/note="propagated from UniProtKB/Swiss-Prot (Q9JJ16.1);
transmembrane region"
misc_feature 831..884
/gene="Htr3b"
/note="propagated from UniProtKB/Swiss-Prot (Q9JJ16.1);
transmembrane region"
misc_feature 918..1004
/gene="Htr3b"
/note="propagated from UniProtKB/Swiss-Prot (Q9JJ16.1);
transmembrane region"
misc_feature 1161..1259
/gene="Htr3b"
/note="propagated from UniProtKB/Swiss-Prot (Q9JJ16.1);
Region: HA-stretch, determines single-channel conductance
in 5-HT3 receptors.
/evidence=ECO:0000250|UniProtKB:O95264"
misc_feature 1263..1334
/gene="Htr3b"
/note="propagated from UniProtKB/Swiss-Prot (Q9JJ16.1);
transmembrane region"
exon 73..233
/gene="Htr3b"
/inference="alignment:Splign:2.1.0"
exon 234..278
/gene="Htr3b"
/inference="alignment:Splign:2.1.0"
exon 279..388
/gene="Htr3b"
/inference="alignment:Splign:2.1.0"
exon 389..558
/gene="Htr3b"
/inference="alignment:Splign:2.1.0"
exon 559..716
/gene="Htr3b"
/inference="alignment:Splign:2.1.0"
exon 717..927
/gene="Htr3b"
/inference="alignment:Splign:2.1.0"
exon 928..1110
/gene="Htr3b"
/inference="alignment:Splign:2.1.0"
exon 1111..1346
/gene="Htr3b"
/inference="alignment:Splign:2.1.0"
ORIGIN
1 tggtacctgc cccagaacaa taggcaagtg cgatgattct tctgtggtcc tgcctcctgg
61 tggctgtcgt aggtattcta ggcacagcga cacctcagcc tgggaattcc tctctgcatc
121 gcctcaccag gcagctgcta cagcagtacc acaaggaggt cagaccagtt tacaactggg
181 ctgaggccac cactgtctac ctggaccttt gcgtccatgc tgtattggat gtggatgtac
241 agaatcaaaa attaaagaca agcatgtggt accgagaggt ttggaatgat gagtttctgt
301 cctggaactc tagtctgttc gatgatattc aagagatctc tctccctctc agtgccatct
361 gggcccctga tatcatcatt aatgagtttg tggatgtcga aaggtctcct gacctgccct
421 atgtatacgt gaactcttcc ggaacgatta gaaaccacaa gcccatccag gtggtctccg
481 catgcagttt gcagacatac gctttcccct ttgatatcca gaactgcagt ctcaccttca
541 atagcatcct gcatacagtg gaagacatag acctgggctt cctgaggaac caagaagaca
601 ttgagaacga caaaaggtct tttctgaatg acagcgagtg gcagcttctt tctgtgacct
661 ccacttacca catccggcag agcagcgctg gtgacttcgc acagattcgg tttaatgtag
721 tgattcgcag atgtccattg gcctatgttg tgagcctctt gattcctagc atcttcctga
781 tgctcgtgga cctgggaagc ttctacttgc cccccaactg tcgtgccaga attgtgttca
841 agaccaatgt gctggtgggc tatacagtct tcagggtcaa catgtctgat gaggtgccaa
901 gaagcgcagg gtgcacatct ctgattgggg tcttctttac cgtctgcatg gccctcttgg
961 ttctcagttt atccaaatcc atcttgttga tcaaattcct ctatgaggag cggcacagtg
1021 agcaagaacg gcctcttatg tgccttcgag gggactctga tgccaatgag tctagattgt
1081 acctcagagc tccatgtgct gaggacacag agtccccggt tcgtcaggag caccaggtcc
1141 catcagatac tctgaaggat ttctggttcc agctccaatc catcaacaac tctctccgaa
1201 ctcgggatca ggtttaccag aaggaggtgg agtggctcgc catcctgtgc cactttgatc
1261 agctgctctt ccgaatctac cttgccgtgc tggggctcta tactgtcacc ttatgctctc
1321 tctgggcact gtggagcagg atgtga
//