Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
NCBI Reference Sequence: XM_039107483.2
FASTA Graphics
LOCUS XM_039107483 781 bp mRNA linear ROD 22-FEB-2024 DEFINITION PREDICTED: Rattus norvegicus mitochondrial ribosomal protein S35 (Mrps35), transcript variant X7, mRNA. ACCESSION XM_039107483 VERSION XM_039107483.2 DBLINK BioProject: PRJNA1074393 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_086022) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Feb 22, 2024 this sequence version replaced XM_039107483.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_036323735.1-RS_2024_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.2 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/09/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..781 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN/NHsdMcwi" /bio_material="RGD 61498" /db_xref="taxon:10116" /chromosome="4" /sex="male" /tissue_type="kidney, spleen, liver" /geo_loc_name="USA: Wisconsin, Milwaukee" /lat_lon="43.05 N 88.04 W" /collected_by="Rebecca Schilling, Melinda Dwinell" gene 1..781 /gene="Mrps35" /note="mitochondrial ribosomal protein S35; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 11 long SRA reads, 2 Proteins" /db_xref="GeneID:297727" /db_xref="RGD:1306720" CDS 48..587 /gene="Mrps35" /codon_start=1 /product="small ribosomal subunit protein mS35 isoform X7" /protein_id="XP_038963411.1" /db_xref="GeneID:297727" /db_xref="RGD:1306720" /translation="MAAASLQLRLTLYPGARGLRTFSSVARPAAPRAGPRTVSRGERP MRRKALPPRTEKMETDQDWPSVYPTAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNVEL LKIPNFLHLTPVAIKRHCGALKDFCTEWPAALDSDEKCEKHFPVEIDTADYVSSGPSI RNPRARAVTLRMPFEAAEL" polyA_site 781 /gene="Mrps35" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gccccgcccc ctcagcgctt gtccgttctg gctcgccgtc cttcagcatg gctgccgctt 61 cgctgcagct aaggctgacc ctatacccgg gagcgcgcgg cctgcgcacc ttctcctcag 121 tcgccaggcc cgcggctcca agagccggcc cgcgtacagt atccagaggt gaaaggccga 181 tgagaagaaa ggcactgcct cctaggacgg agaagatgga gactgaccag gactggccca 241 gcgtttaccc tactgctgca ccgtttaaac cctcggctgt tcctctacct gttcgaatgg 301 gatatccagt gaagaagggt gtgcccatgg cgaaggaggg gaatgtagag cttctaaaga 361 tcccaaattt tctgcatttg actcctgtgg caattaaaag gcactgcgga gctctaaaag 421 atttctgcac tgagtggcca gctgcactcg acagtgatga gaaatgtgag aagcattttc 481 cagtcgagat tgacacagcg gattatgtgt catcaggacc gtccattcga aaccccagag 541 cgcgagcggt aactttaagg atgccctttg aagcggcaga actatgacta tgcaatgtat 601 ctccttacag tcctgtacca tgaatcttgg aaaactgaag aatgggaaaa aaataagact 661 gaggaagaca tggatgagta tgtgtgggcg aagagctcct cggagaacag cgtcctccag 721 accctgctgc agatgagagc tgccgagagc agtgtggcgc cgagcagaga agagctgctg 781 g //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on