NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|485602274|pdb|1NH5|A]
View 

Chain A, Neurotoxin 5

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
neurotoxins_LC_scorpion cd23106
long-chain neurotoxins from scorpions; Scorpion venoms contain groups of neurotoxins active ...
 2-59 2.37e-16

long-chain neurotoxins from scorpions; Scorpion venoms contain groups of neurotoxins active specifically on mammals or insects. These peptide toxins can be classified into two main categories based on their molecular sizes and pharmacological actions. Short-chain toxins, composed of 30-40 amino acid residues with 3 or 4 disulfide bonds, affect mainly potassium or chloride channels, while long-chain toxins, composed of 60-70 amino acid residues with 4 disulfide bonds, affect mainly sodium channels and can be divided into two groups, the alpha and beta toxins. The alpha toxins bind in a voltage-dependent manner and modulate the sodium current inactivation stage, whereas binding of beta toxins is voltage-independent and interferes with the sodium current activation stage. The beta toxin class includes the groups of excitatory and depressant toxins, which differ in their mode of action and are highly specific against insects. They can selectively bind to the corresponding channels on the membrane of excitable cells, thus impairing the initial rapid depolarization phase of the action potential in nerve and muscle, resulting in neurotoxicity. This family contains the long-chain alpha and beta toxins from scorpion venom.


:

Pssm-ID: 467870  Cd Length: 60  Bit Score: 64.96  E-value: 2.37e-16
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|
1NH5_A       2 DGYPVDSKGCKLSCVANN-YCDNQCKMKKASGGHCYA-MSCYCEGLPENAKVSDSATNIC 59
Cdd:cd23106  1 DGYPVDSDGCKYSCLIENeYCNKECKKKGGSSGYCYWwLACWCEGLPDNVPIWDSETNKC 60
 
Name Accession Description Interval E-value
neurotoxins_LC_scorpion cd23106
long-chain neurotoxins from scorpions; Scorpion venoms contain groups of neurotoxins active ...
 2-59 2.37e-16

long-chain neurotoxins from scorpions; Scorpion venoms contain groups of neurotoxins active specifically on mammals or insects. These peptide toxins can be classified into two main categories based on their molecular sizes and pharmacological actions. Short-chain toxins, composed of 30-40 amino acid residues with 3 or 4 disulfide bonds, affect mainly potassium or chloride channels, while long-chain toxins, composed of 60-70 amino acid residues with 4 disulfide bonds, affect mainly sodium channels and can be divided into two groups, the alpha and beta toxins. The alpha toxins bind in a voltage-dependent manner and modulate the sodium current inactivation stage, whereas binding of beta toxins is voltage-independent and interferes with the sodium current activation stage. The beta toxin class includes the groups of excitatory and depressant toxins, which differ in their mode of action and are highly specific against insects. They can selectively bind to the corresponding channels on the membrane of excitable cells, thus impairing the initial rapid depolarization phase of the action potential in nerve and muscle, resulting in neurotoxicity. This family contains the long-chain alpha and beta toxins from scorpion venom.


Pssm-ID: 467870  Cd Length: 60  Bit Score: 64.96  E-value: 2.37e-16
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|
1NH5_A       2 DGYPVDSKGCKLSCVANN-YCDNQCKMKKASGGHCYA-MSCYCEGLPENAKVSDSATNIC 59
Cdd:cd23106  1 DGYPVDSDGCKYSCLIENeYCNKECKKKGGSSGYCYWwLACWCEGLPDNVPIWDSETNKC 60
Toxin_3 pfam00537
Scorpion toxin-like domain; This family contains both neurotoxins and plant defensins. The ...
 1-49 2.89e-09

Scorpion toxin-like domain; This family contains both neurotoxins and plant defensins. The mustard trypsin inhibitor, MTI-2, is plant defensin. It is a potent inhibitor of trypsin with no activity towards chymotrypsin. MTI-2 is toxic for Lepidopteran insects, but has low activity against aphids. Brazzein is plant defensin-like protein. It is pH-stable, heat-stable and intensely sweet protein. The scorpion toxin (a neurotoxin) binds to sodium channels and inhibits the activation mechanisms of the channels, thereby blocking neuronal transmission. Scorpion toxins bind to sodium channels and inhibit the activation mechanisms of the channels, thereby blocking neuronal transmission


Pssm-ID: 395428  Cd Length: 55  Bit Score: 46.92  E-value: 2.89e-09
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
1NH5_A         1 KDGYPVDSKGCKLSCVANN-YCDNQCKMKKASGGHC-----YAMSCYCEGLPENA 49
Cdd:pfam00537  1 RDGYIAKEYNCVYSCAPRNsYCDKLCKKNGAKSGYCqwgggYGNACWCYGLPDNV 55
 
Name Accession Description Interval E-value
neurotoxins_LC_scorpion cd23106
long-chain neurotoxins from scorpions; Scorpion venoms contain groups of neurotoxins active ...
 2-59 2.37e-16

long-chain neurotoxins from scorpions; Scorpion venoms contain groups of neurotoxins active specifically on mammals or insects. These peptide toxins can be classified into two main categories based on their molecular sizes and pharmacological actions. Short-chain toxins, composed of 30-40 amino acid residues with 3 or 4 disulfide bonds, affect mainly potassium or chloride channels, while long-chain toxins, composed of 60-70 amino acid residues with 4 disulfide bonds, affect mainly sodium channels and can be divided into two groups, the alpha and beta toxins. The alpha toxins bind in a voltage-dependent manner and modulate the sodium current inactivation stage, whereas binding of beta toxins is voltage-independent and interferes with the sodium current activation stage. The beta toxin class includes the groups of excitatory and depressant toxins, which differ in their mode of action and are highly specific against insects. They can selectively bind to the corresponding channels on the membrane of excitable cells, thus impairing the initial rapid depolarization phase of the action potential in nerve and muscle, resulting in neurotoxicity. This family contains the long-chain alpha and beta toxins from scorpion venom.


Pssm-ID: 467870  Cd Length: 60  Bit Score: 64.96  E-value: 2.37e-16
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|
1NH5_A       2 DGYPVDSKGCKLSCVANN-YCDNQCKMKKASGGHCYA-MSCYCEGLPENAKVSDSATNIC 59
Cdd:cd23106  1 DGYPVDSDGCKYSCLIENeYCNKECKKKGGSSGYCYWwLACWCEGLPDNVPIWDSETNKC 60
Toxin_3 pfam00537
Scorpion toxin-like domain; This family contains both neurotoxins and plant defensins. The ...
 1-49 2.89e-09

Scorpion toxin-like domain; This family contains both neurotoxins and plant defensins. The mustard trypsin inhibitor, MTI-2, is plant defensin. It is a potent inhibitor of trypsin with no activity towards chymotrypsin. MTI-2 is toxic for Lepidopteran insects, but has low activity against aphids. Brazzein is plant defensin-like protein. It is pH-stable, heat-stable and intensely sweet protein. The scorpion toxin (a neurotoxin) binds to sodium channels and inhibits the activation mechanisms of the channels, thereby blocking neuronal transmission. Scorpion toxins bind to sodium channels and inhibit the activation mechanisms of the channels, thereby blocking neuronal transmission


Pssm-ID: 395428  Cd Length: 55  Bit Score: 46.92  E-value: 2.89e-09
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
1NH5_A         1 KDGYPVDSKGCKLSCVANN-YCDNQCKMKKASGGHC-----YAMSCYCEGLPENA 49
Cdd:pfam00537  1 RDGYIAKEYNCVYSCAPRNsYCDKLCKKNGAKSGYCqwgggYGNACWCYGLPDNV 55
Knot1 cd00107
The "knottin" fold is stable cysteine-rich scaffold, in which one disulfide bridge crosses the ...
 14-43 1.67e-03

The "knottin" fold is stable cysteine-rich scaffold, in which one disulfide bridge crosses the macrocycle made by two other disulfide bridges and the connecting backbone segments. Members include plant lectins/antimicrobial peptides, plant proteinase/amylase inhibitors, plant gamma-thionins, and arthropod defensins.


Pssm-ID: 238055  Cd Length: 33  Bit Score: 31.94  E-value: 1.67e-03
                       10        20        30
               ....*....|....*....|....*....|..
1NH5_A      14 SCVANNYCDNQCKMKKASGGHCY--AMSCYCE 43
Cdd:cd00107  2 TCFSDSYCDKECKKKGASGGYCYgqGLACWCY 33
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH