NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|35165151|gb|AAQ84105|]
View 

central open reading frame (endogenous virus) [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
HERV-K_REC pfam15695
Rec (regulator of expression encoded by corf) of HERV-K-113; REC is a family of rec proteins ...
 23-105 6.96e-38

Rec (regulator of expression encoded by corf) of HERV-K-113; REC is a family of rec proteins from the HERV-K viral polyprotein family. Rec is a functional homolog of Rev and Rex, and binds to an RNA element, the Rec-responsive element (RcRE), in the 3'LTR of HTDV/HERV-K transcripts. Thus Rec mediates nuclear export of RNA by binding to its responsive element, RcRE, present in a transcript. The human small glutamine-rich tetratricopeptide repeat-containing protein (hSGT) that controls mitotic processes and is a checkpoint protein during pro-metaphase is found to be a Rec-interacting partner.interferes with its role as a negative regulator of the androgen receptor, leading to enhanced androgen receptor activity. HERV-K(HML-2) elements benefit from this enhanced activity, as this leads to a vicious cycle that can result in increased cell proliferation, an inhibition of apoptosis, and eventually tumourigenesis.


:

Pssm-ID: 292323  Cd Length: 87  Bit Score: 122.28  E-value: 6.96e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 35165151    23 LTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETATIE 102
Cdd:pfam15695   5 LTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGPMNAGAAAANIE 84


                  ...
gi 35165151   103 NGP 105
Cdd:pfam15695  85 NGA 87
 
Name Accession Description Interval E-value
HERV-K_REC pfam15695
Rec (regulator of expression encoded by corf) of HERV-K-113; REC is a family of rec proteins ...
 23-105 6.96e-38

Rec (regulator of expression encoded by corf) of HERV-K-113; REC is a family of rec proteins from the HERV-K viral polyprotein family. Rec is a functional homolog of Rev and Rex, and binds to an RNA element, the Rec-responsive element (RcRE), in the 3'LTR of HTDV/HERV-K transcripts. Thus Rec mediates nuclear export of RNA by binding to its responsive element, RcRE, present in a transcript. The human small glutamine-rich tetratricopeptide repeat-containing protein (hSGT) that controls mitotic processes and is a checkpoint protein during pro-metaphase is found to be a Rec-interacting partner.interferes with its role as a negative regulator of the androgen receptor, leading to enhanced androgen receptor activity. HERV-K(HML-2) elements benefit from this enhanced activity, as this leads to a vicious cycle that can result in increased cell proliferation, an inhibition of apoptosis, and eventually tumourigenesis.


Pssm-ID: 292323  Cd Length: 87  Bit Score: 122.28  E-value: 6.96e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 35165151    23 LTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETATIE 102
Cdd:pfam15695   5 LTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGPMNAGAAAANIE 84


                  ...
gi 35165151   103 NGP 105
Cdd:pfam15695  85 NGA 87
 
Name Accession Description Interval E-value
HERV-K_REC pfam15695
Rec (regulator of expression encoded by corf) of HERV-K-113; REC is a family of rec proteins ...
 23-105 6.96e-38

Rec (regulator of expression encoded by corf) of HERV-K-113; REC is a family of rec proteins from the HERV-K viral polyprotein family. Rec is a functional homolog of Rev and Rex, and binds to an RNA element, the Rec-responsive element (RcRE), in the 3'LTR of HTDV/HERV-K transcripts. Thus Rec mediates nuclear export of RNA by binding to its responsive element, RcRE, present in a transcript. The human small glutamine-rich tetratricopeptide repeat-containing protein (hSGT) that controls mitotic processes and is a checkpoint protein during pro-metaphase is found to be a Rec-interacting partner.interferes with its role as a negative regulator of the androgen receptor, leading to enhanced androgen receptor activity. HERV-K(HML-2) elements benefit from this enhanced activity, as this leads to a vicious cycle that can result in increased cell proliferation, an inhibition of apoptosis, and eventually tumourigenesis.


Pssm-ID: 292323  Cd Length: 87  Bit Score: 122.28  E-value: 6.96e-38
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 35165151    23 LTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETATIE 102
Cdd:pfam15695   5 LTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGPMNAGAAAANIE 84


                  ...
gi 35165151   103 NGP 105
Cdd:pfam15695  85 NGA 87
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH