NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|119596860|gb|EAW76454|]
View 

hCG1644187, isoform CRA_a, partial [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Dkkl1 super family cl45536
Dickkopf-like protein 1; Dickkopf (Dkk) genes comprise an evolutionarily conserved small gene ...
 67-126 1.96e-30

Dickkopf-like protein 1; Dickkopf (Dkk) genes comprise an evolutionarily conserved small gene family of four members (Dkk1-4) and a unique Dkk3-related gene, Dkkl1, also called Dickkopf-like protein 1, cancer/testis antigen 34 (CT34), or sgy/soggy. Soggy is thought to play an important role in testicular development and spermatogenesis, and its abnormal expression may be an important factor in male infertility. It may promote spermatocyte apoptosis, thereby limiting sperm production. In adults, Dkkl1 may reduce testosterone synthesis in Leydig cells. Unlike the other members of the Dickkopf family, Soggy does not contain two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. It contains an N-terminal domain similar to that of the N-terminal region of Dkk3.


The actual alignment was detected with superfamily member cd23006:

Pssm-ID: 438556  Cd Length: 166  Bit Score: 108.53  E-value: 1.96e-30
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 119596860  67 DFRGLPRNYQQEENEEHQLRNNTLSSHLHIDKVTDNKTGEVLISEKVVASIQPAEGSFEG 126
Cdd:cd23006    1 DFRGLPRNYHKEENQEHRLGNSTLSSHLQIDKVTDNQTGEVLISEKVVAAIQPAEGNFEG 60
 
Name Accession Description Interval E-value
Dkkl1 cd23006
Dickkopf-like protein 1; Dickkopf (Dkk) genes comprise an evolutionarily conserved small gene ...
 67-126 1.96e-30

Dickkopf-like protein 1; Dickkopf (Dkk) genes comprise an evolutionarily conserved small gene family of four members (Dkk1-4) and a unique Dkk3-related gene, Dkkl1, also called Dickkopf-like protein 1, cancer/testis antigen 34 (CT34), or sgy/soggy. Soggy is thought to play an important role in testicular development and spermatogenesis, and its abnormal expression may be an important factor in male infertility. It may promote spermatocyte apoptosis, thereby limiting sperm production. In adults, Dkkl1 may reduce testosterone synthesis in Leydig cells. Unlike the other members of the Dickkopf family, Soggy does not contain two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. It contains an N-terminal domain similar to that of the N-terminal region of Dkk3.


Pssm-ID: 438556  Cd Length: 166  Bit Score: 108.53  E-value: 1.96e-30
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 119596860  67 DFRGLPRNYQQEENEEHQLRNNTLSSHLHIDKVTDNKTGEVLISEKVVASIQPAEGSFEG 126
Cdd:cd23006    1 DFRGLPRNYHKEENQEHRLGNSTLSSHLQIDKVTDNQTGEVLISEKVVAAIQPAEGNFEG 60
 
Name Accession Description Interval E-value
Dkkl1 cd23006
Dickkopf-like protein 1; Dickkopf (Dkk) genes comprise an evolutionarily conserved small gene ...
 67-126 1.96e-30

Dickkopf-like protein 1; Dickkopf (Dkk) genes comprise an evolutionarily conserved small gene family of four members (Dkk1-4) and a unique Dkk3-related gene, Dkkl1, also called Dickkopf-like protein 1, cancer/testis antigen 34 (CT34), or sgy/soggy. Soggy is thought to play an important role in testicular development and spermatogenesis, and its abnormal expression may be an important factor in male infertility. It may promote spermatocyte apoptosis, thereby limiting sperm production. In adults, Dkkl1 may reduce testosterone synthesis in Leydig cells. Unlike the other members of the Dickkopf family, Soggy does not contain two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. It contains an N-terminal domain similar to that of the N-terminal region of Dkk3.


Pssm-ID: 438556  Cd Length: 166  Bit Score: 108.53  E-value: 1.96e-30
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 119596860  67 DFRGLPRNYQQEENEEHQLRNNTLSSHLHIDKVTDNKTGEVLISEKVVASIQPAEGSFEG 126
Cdd:cd23006    1 DFRGLPRNYHKEENQEHRLGNSTLSSHLQIDKVTDNQTGEVLISEKVVAAIQPAEGNFEG 60
Dkk3_N_Cys1 cd23014
N-terminus of Dickkopf-related protein 3; includes the first cysteine-rich (Cys-1) domain; ...
 66-122 8.61e-13

N-terminus of Dickkopf-related protein 3; includes the first cysteine-rich (Cys-1) domain; Dickkopf 3 (Dkk3) is a secreted protein which, in contrast to Dkk1, Dkk2, and Dkk4, does not interact with LRP5/6 (low-density lipoprotein receptor related protein 5 and 6), and thus is a divergent family member that is not considered a true Wnt signaling antagonist. The role of Dkk proteins in cancer is considered mainly tumor suppressive since they are usually down-regulated in cancer cells. Dkk3 links heat shock factor 1 (HSF1) and YAP/TAZ signaling to control aggressive behaviors in cancer-associated fibroblasts; it does so via canonical Wnt signaling. It belongs to the Dickkopf (Dkk) family that comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the N-terminal region of Dkk3, including the Cys-1 domain and a region to its N-terminus that shows similarity to Dickkopf-like protein 1 (Dkkl1).


Pssm-ID: 438008  Cd Length: 156  Bit Score: 62.50  E-value: 8.61e-13
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 119596860  66 MDFRGLPRNYQQEENEEHQLRNNTLSSHLHIDKVTDNKTGEVLISEKVVASIQPAEG 122
Cdd:cd23014   45 VNLANLPPNYHNESNTETKVGNNTIHTHQEIDKVTDNKTGSTVFSETVITSVGDEEG 101
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH