NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2251723686|ref|NP_001395086|]
View 

post-GPI attachment to proteins factor 2 isoform 21 [Mus musculus]

Protein Classification

Frag1/DRAM/Sfk1 family protein( domain architecture ID 3498)

Frag1/DRAM/Sfk1 family protein, similar to Frag1 (FGF receptor activating protein 1), a membrane-spanning protein that is conserved from fungi to humans, and to DNA damage-regulated autophagy modulator protein

PubMed:  16839881|10585768

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Frag1 super family cl10957
Frag1/DRAM/Sfk1 family; This family includes Frag1, DRAM and Sfk1 proteins. Frag1 (FGF ...
 1-85 6.24e-15

Frag1/DRAM/Sfk1 family; This family includes Frag1, DRAM and Sfk1 proteins. Frag1 (FGF receptor activating protein 1) is a protein that is conserved from fungi to humans. There are four potential iso-prenylation sites throughout the peptide, viz CILW, CIIW and CIGL. Frag1 is a membrane-spanning protein that is ubiquitously expressed in adult tissues suggesting an important cellular function. Dram is a family of proteins conserved from nematodes to humans with six hydrophobic transmembrane regions and an Endoplasmic Reticulum signal peptide. It is a lysosomal protein that induces macro-autophagy as an effector of p53-mediated death, where p53 is the tumour-suppressor gene that is frequently mutated in cancer. Expression of Dram is stress-induced. This region is also part of a family of small plasma membrane proteins, referred to as Sfk1, that may act together with or upstream of Stt4p to generate normal levels of the essential phospholipid PI4P, thus allowing proper localization of Stt4p to the actin cytoskeleton.


The actual alignment was detected with superfamily member pfam10277:

Pssm-ID: 431193  Cd Length: 220  Bit Score: 66.90  E-value: 6.24e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2251723686   1 MLLTCILWRLTKKHtVSQEDRKSYSWKQRLFVINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWW 80
Cdd:pfam10277 137 MLLQTALSYRLGPH-YTPKSRKSFRLKLVLLILAFVSAVAFIVFFIRHKKHCGYGAYSLSAIFEWLLALSFIFFFGTFAV 215


                  ....*
gi 2251723686  81 DFGNK 85
Cdd:pfam10277 216 DFKPI 220
 
Name Accession Description Interval E-value
Frag1 pfam10277
Frag1/DRAM/Sfk1 family; This family includes Frag1, DRAM and Sfk1 proteins. Frag1 (FGF ...
 1-85 6.24e-15

Frag1/DRAM/Sfk1 family; This family includes Frag1, DRAM and Sfk1 proteins. Frag1 (FGF receptor activating protein 1) is a protein that is conserved from fungi to humans. There are four potential iso-prenylation sites throughout the peptide, viz CILW, CIIW and CIGL. Frag1 is a membrane-spanning protein that is ubiquitously expressed in adult tissues suggesting an important cellular function. Dram is a family of proteins conserved from nematodes to humans with six hydrophobic transmembrane regions and an Endoplasmic Reticulum signal peptide. It is a lysosomal protein that induces macro-autophagy as an effector of p53-mediated death, where p53 is the tumour-suppressor gene that is frequently mutated in cancer. Expression of Dram is stress-induced. This region is also part of a family of small plasma membrane proteins, referred to as Sfk1, that may act together with or upstream of Stt4p to generate normal levels of the essential phospholipid PI4P, thus allowing proper localization of Stt4p to the actin cytoskeleton.


Pssm-ID: 431193  Cd Length: 220  Bit Score: 66.90  E-value: 6.24e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2251723686   1 MLLTCILWRLTKKHtVSQEDRKSYSWKQRLFVINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWW 80
Cdd:pfam10277 137 MLLQTALSYRLGPH-YTPKSRKSFRLKLVLLILAFVSAVAFIVFFIRHKKHCGYGAYSLSAIFEWLLALSFIFFFGTFAV 215


                  ....*
gi 2251723686  81 DFGNK 85
Cdd:pfam10277 216 DFKPI 220
 
Name Accession Description Interval E-value
Frag1 pfam10277
Frag1/DRAM/Sfk1 family; This family includes Frag1, DRAM and Sfk1 proteins. Frag1 (FGF ...
 1-85 6.24e-15

Frag1/DRAM/Sfk1 family; This family includes Frag1, DRAM and Sfk1 proteins. Frag1 (FGF receptor activating protein 1) is a protein that is conserved from fungi to humans. There are four potential iso-prenylation sites throughout the peptide, viz CILW, CIIW and CIGL. Frag1 is a membrane-spanning protein that is ubiquitously expressed in adult tissues suggesting an important cellular function. Dram is a family of proteins conserved from nematodes to humans with six hydrophobic transmembrane regions and an Endoplasmic Reticulum signal peptide. It is a lysosomal protein that induces macro-autophagy as an effector of p53-mediated death, where p53 is the tumour-suppressor gene that is frequently mutated in cancer. Expression of Dram is stress-induced. This region is also part of a family of small plasma membrane proteins, referred to as Sfk1, that may act together with or upstream of Stt4p to generate normal levels of the essential phospholipid PI4P, thus allowing proper localization of Stt4p to the actin cytoskeleton.


Pssm-ID: 431193  Cd Length: 220  Bit Score: 66.90  E-value: 6.24e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2251723686   1 MLLTCILWRLTKKHtVSQEDRKSYSWKQRLFVINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWW 80
Cdd:pfam10277 137 MLLQTALSYRLGPH-YTPKSRKSFRLKLVLLILAFVSAVAFIVFFIRHKKHCGYGAYSLSAIFEWLLALSFIFFFGTFAV 215


                  ....*
gi 2251723686  81 DFGNK 85
Cdd:pfam10277 216 DFKPI 220
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH