NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1215372692|gb|OXB44891|]
View 

hypothetical protein B1J91_C01919g [Nakaseomyces glabratus]

Protein Classification

MFA1_2 domain-containing protein( domain architecture ID 13879682)

MFA1_2 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MFA1_2 pfam17317
Mating hormone A-factor 1_2; The polypeptides encoded by the MFa1 and MFa2 genes are ...
1-34 2.28e-18

Mating hormone A-factor 1_2; The polypeptides encoded by the MFa1 and MFa2 genes are precursors of 36 and 38 amino acids, respectively. These mating pheromones secreted by S. cerevisiae a-cells, exhibit a single amino acid residue difference (the MFa1 gene product contains a valine instead of the leucine coded for by MFa2 at position 6 of the mature a-factor). The most significant feature of the primary a-factor gene products is the presence of a specific C-terminal motif, found in all known farnesylated proteins, representing a signal for modification of polypeptides with an isoprenoid group. In the case of both a-factor precursors, this specific sequence of amino acids is -CVIA. However, the general motif is referred to as a CAAX box, since the consensus sequence of amino acids present at the C terminus of isoprenylated proteins consists of an invariable cysteine (C) residue followed by two aliphatic (A) amino acids and ending in a carboxyl-terminal residue of almost any (X) type The specific CAAX sequence has also been shown to target the peptide for either farnesylation or geranylgeranylation.


:

Pssm-ID: 407425  Cd Length: 34  Bit Score: 68.23  E-value: 2.28e-18
                         10        20        30
                 ....*....|....*....|....*....|....
gi 1215372692  1 MQPTIEATQKDNTQEKRDNYIVKGFFWSPDCVIA 34
Cdd:pfam17317  1 MQPTTQATQKDNSSEKKDNYIVKGYFWDPQCVIA 34
 
Name Accession Description Interval E-value
MFA1_2 pfam17317
Mating hormone A-factor 1_2; The polypeptides encoded by the MFa1 and MFa2 genes are ...
1-34 2.28e-18

Mating hormone A-factor 1_2; The polypeptides encoded by the MFa1 and MFa2 genes are precursors of 36 and 38 amino acids, respectively. These mating pheromones secreted by S. cerevisiae a-cells, exhibit a single amino acid residue difference (the MFa1 gene product contains a valine instead of the leucine coded for by MFa2 at position 6 of the mature a-factor). The most significant feature of the primary a-factor gene products is the presence of a specific C-terminal motif, found in all known farnesylated proteins, representing a signal for modification of polypeptides with an isoprenoid group. In the case of both a-factor precursors, this specific sequence of amino acids is -CVIA. However, the general motif is referred to as a CAAX box, since the consensus sequence of amino acids present at the C terminus of isoprenylated proteins consists of an invariable cysteine (C) residue followed by two aliphatic (A) amino acids and ending in a carboxyl-terminal residue of almost any (X) type The specific CAAX sequence has also been shown to target the peptide for either farnesylation or geranylgeranylation.


Pssm-ID: 407425  Cd Length: 34  Bit Score: 68.23  E-value: 2.28e-18
                         10        20        30
                 ....*....|....*....|....*....|....
gi 1215372692  1 MQPTIEATQKDNTQEKRDNYIVKGFFWSPDCVIA 34
Cdd:pfam17317  1 MQPTTQATQKDNSSEKKDNYIVKGYFWDPQCVIA 34
 
Name Accession Description Interval E-value
MFA1_2 pfam17317
Mating hormone A-factor 1_2; The polypeptides encoded by the MFa1 and MFa2 genes are ...
1-34 2.28e-18

Mating hormone A-factor 1_2; The polypeptides encoded by the MFa1 and MFa2 genes are precursors of 36 and 38 amino acids, respectively. These mating pheromones secreted by S. cerevisiae a-cells, exhibit a single amino acid residue difference (the MFa1 gene product contains a valine instead of the leucine coded for by MFa2 at position 6 of the mature a-factor). The most significant feature of the primary a-factor gene products is the presence of a specific C-terminal motif, found in all known farnesylated proteins, representing a signal for modification of polypeptides with an isoprenoid group. In the case of both a-factor precursors, this specific sequence of amino acids is -CVIA. However, the general motif is referred to as a CAAX box, since the consensus sequence of amino acids present at the C terminus of isoprenylated proteins consists of an invariable cysteine (C) residue followed by two aliphatic (A) amino acids and ending in a carboxyl-terminal residue of almost any (X) type The specific CAAX sequence has also been shown to target the peptide for either farnesylation or geranylgeranylation.


Pssm-ID: 407425  Cd Length: 34  Bit Score: 68.23  E-value: 2.28e-18
                         10        20        30
                 ....*....|....*....|....*....|....
gi 1215372692  1 MQPTIEATQKDNTQEKRDNYIVKGFFWSPDCVIA 34
Cdd:pfam17317  1 MQPTTQATQKDNSSEKKDNYIVKGYFWDPQCVIA 34
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH