MULTISPECIES: glucan-binding protein [Bacillus]
List of domain hits
Name | Accession | Description | Interval | E-value | |||||
pneumo_PspA super family | cl41532 | pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ... |
41-305 | 1.89e-59 | |||||
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus. The actual alignment was detected with superfamily member NF033930: Pssm-ID: 468251 [Multi-domain] Cd Length: 660 Bit Score: 202.45 E-value: 1.89e-59
|
|||||||||
PspC_relate_1 super family | cl41464 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
273-351 | 8.92e-20 | |||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. The actual alignment was detected with superfamily member NF033840: Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 90.53 E-value: 8.92e-20
|
|||||||||
Name | Accession | Description | Interval | E-value | |||||
pneumo_PspA | NF033930 | pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ... |
41-305 | 1.89e-59 | |||||
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus. Pssm-ID: 468251 [Multi-domain] Cd Length: 660 Bit Score: 202.45 E-value: 1.89e-59
|
|||||||||
pneumo_PspA | NF033930 | pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ... |
123-343 | 1.68e-56 | |||||
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus. Pssm-ID: 468251 [Multi-domain] Cd Length: 660 Bit Score: 194.75 E-value: 1.68e-56
|
|||||||||
PspC_subgroup_1 | NF033838 | pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ... |
123-342 | 1.07e-53 | |||||
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. Pssm-ID: 468201 [Multi-domain] Cd Length: 684 Bit Score: 187.53 E-value: 1.07e-53
|
|||||||||
PspC_subgroup_1 | NF033838 | pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ... |
20-251 | 1.16e-52 | |||||
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. Pssm-ID: 468201 [Multi-domain] Cd Length: 684 Bit Score: 184.83 E-value: 1.16e-52
|
|||||||||
PspC_subgroup_1 | NF033838 | pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ... |
101-305 | 3.39e-52 | |||||
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. Pssm-ID: 468201 [Multi-domain] Cd Length: 684 Bit Score: 183.29 E-value: 3.39e-52
|
|||||||||
PspC_subgroup_1 | NF033838 | pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ... |
149-351 | 6.72e-46 | |||||
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. Pssm-ID: 468201 [Multi-domain] Cd Length: 684 Bit Score: 165.96 E-value: 6.72e-46
|
|||||||||
COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
41-226 | 1.98e-43 | |||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 156.57 E-value: 1.98e-43
|
|||||||||
PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
103-251 | 2.28e-37 | |||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 141.76 E-value: 2.28e-37
|
|||||||||
PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
183-342 | 2.45e-36 | |||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 139.06 E-value: 2.45e-36
|
|||||||||
PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
234-351 | 3.11e-23 | |||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 100.93 E-value: 3.11e-23
|
|||||||||
PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
273-351 | 8.92e-20 | |||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 90.53 E-value: 8.92e-20
|
|||||||||
PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
291-351 | 3.77e-14 | |||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 73.58 E-value: 3.77e-14
|
|||||||||
Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
160-204 | 8.84e-08 | |||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 47.92 E-value: 8.84e-08
|
|||||||||
glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
111-169 | 1.01e-05 | |||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 42.51 E-value: 1.01e-05
|
|||||||||
Name | Accession | Description | Interval | E-value | ||||||
pneumo_PspA | NF033930 | pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ... |
41-305 | 1.89e-59 | ||||||
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus. Pssm-ID: 468251 [Multi-domain] Cd Length: 660 Bit Score: 202.45 E-value: 1.89e-59
|
||||||||||
pneumo_PspA | NF033930 | pneumococcal surface protein A; The pneumococcal surface protein proteins, found in ... |
123-343 | 1.68e-56 | ||||||
pneumococcal surface protein A; The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus. Pssm-ID: 468251 [Multi-domain] Cd Length: 660 Bit Score: 194.75 E-value: 1.68e-56
|
||||||||||
PspC_subgroup_1 | NF033838 | pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ... |
123-342 | 1.07e-53 | ||||||
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. Pssm-ID: 468201 [Multi-domain] Cd Length: 684 Bit Score: 187.53 E-value: 1.07e-53
|
||||||||||
PspC_subgroup_1 | NF033838 | pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ... |
20-251 | 1.16e-52 | ||||||
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. Pssm-ID: 468201 [Multi-domain] Cd Length: 684 Bit Score: 184.83 E-value: 1.16e-52
|
||||||||||
PspC_subgroup_1 | NF033838 | pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ... |
101-305 | 3.39e-52 | ||||||
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. Pssm-ID: 468201 [Multi-domain] Cd Length: 684 Bit Score: 183.29 E-value: 3.39e-52
|
||||||||||
PspC_subgroup_1 | NF033838 | pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, ... |
149-351 | 6.72e-46 | ||||||
pneumococcal surface protein PspC, choline-binding form; The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. Pssm-ID: 468201 [Multi-domain] Cd Length: 684 Bit Score: 165.96 E-value: 6.72e-46
|
||||||||||
COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
41-226 | 1.98e-43 | ||||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 156.57 E-value: 1.98e-43
|
||||||||||
COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
21-352 | 4.38e-43 | ||||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 155.41 E-value: 4.38e-43
|
||||||||||
COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
36-273 | 1.70e-42 | ||||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 153.87 E-value: 1.70e-42
|
||||||||||
COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
46-351 | 5.89e-39 | ||||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 144.24 E-value: 5.89e-39
|
||||||||||
PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
103-251 | 2.28e-37 | ||||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 141.76 E-value: 2.28e-37
|
||||||||||
PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
183-342 | 2.45e-36 | ||||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 139.06 E-value: 2.45e-36
|
||||||||||
COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
41-351 | 5.01e-33 | ||||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 128.06 E-value: 5.01e-33
|
||||||||||
COG5263 | COG5263 | Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; |
44-351 | 5.44e-24 | ||||||
Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism]; Pssm-ID: 444077 [Multi-domain] Cd Length: 486 Bit Score: 102.64 E-value: 5.44e-24
|
||||||||||
PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
234-351 | 3.11e-23 | ||||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 100.93 E-value: 3.11e-23
|
||||||||||
PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
273-351 | 8.92e-20 | ||||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 90.53 E-value: 8.92e-20
|
||||||||||
PspC_relate_1 | NF033840 | PspC-related protein choline-binding protein 1; Members of this family share C-terminal ... |
291-351 | 3.77e-14 | ||||||
PspC-related protein choline-binding protein 1; Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC. Pssm-ID: 411409 [Multi-domain] Cd Length: 648 Bit Score: 73.58 E-value: 3.77e-14
|
||||||||||
Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
160-204 | 8.84e-08 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 47.92 E-value: 8.84e-08
|
||||||||||
Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
185-226 | 6.47e-07 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 45.61 E-value: 6.47e-07
|
||||||||||
Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
142-186 | 3.86e-06 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 43.30 E-value: 3.86e-06
|
||||||||||
Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
61-97 | 5.89e-06 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 42.91 E-value: 5.89e-06
|
||||||||||
glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
111-169 | 1.01e-05 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 42.51 E-value: 1.01e-05
|
||||||||||
glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
151-206 | 3.99e-05 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 40.97 E-value: 3.99e-05
|
||||||||||
glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
131-186 | 5.68e-05 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 40.58 E-value: 5.68e-05
|
||||||||||
Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
103-136 | 7.51e-05 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 39.83 E-value: 7.51e-05
|
||||||||||
Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
81-122 | 3.48e-04 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 37.91 E-value: 3.48e-04
|
||||||||||
glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
53-97 | 3.83e-04 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 38.27 E-value: 3.83e-04
|
||||||||||
Choline_bind_3 | pfam19127 | Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to ... |
49-82 | 3.04e-03 | ||||||
Choline-binding repeat; Pair of presumed choline-binding repeats often found adjacent to pfam01473. Pssm-ID: 465978 [Multi-domain] Cd Length: 47 Bit Score: 35.21 E-value: 3.04e-03
|
||||||||||
glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
196-251 | 3.47e-03 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 35.57 E-value: 3.47e-03
|
||||||||||
glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
72-136 | 4.23e-03 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 35.19 E-value: 4.23e-03
|
||||||||||
glucan_65_rpt | TIGR04035 | glucan-binding repeat; This model describes a region of about 63 amino acids that is composed ... |
176-217 | 4.27e-03 | ||||||
glucan-binding repeat; This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473. Pssm-ID: 274933 [Multi-domain] Cd Length: 62 Bit Score: 35.19 E-value: 4.27e-03
|
||||||||||
Blast search parameters | ||||
|