NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|486199014|ref|WP_001548170|]
View 

MULTISPECIES: type IV toxin-antitoxin system YeeU family antitoxin [Enterobacterales]

Protein Classification

type IV toxin-antitoxin system YeeU family antitoxin( domain architecture ID 10533045)

type IV toxin-antitoxin (TA) system YeeU (CbeA) family antitoxin similar to Escherichia coli YeeU, which antagonizes CbtA (YeeV) toxicity via the bundling of cytoskeletal polymers; does not bind to the toxin but instead binds to the toxin targets

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CbeA_antitoxin pfam06154
CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A; CbeA_antitoxin is a family ...
6-104 1.18e-64

CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A; CbeA_antitoxin is a family of cognate antitoxins to the CbtA toxins that act by inhibiting the polymerization of cytoskeletal proteins, see pfam06755. These are classified as a type IV toxin-antitoxin system. The family includes three proteins from E. coli YagB, YeeU and YfjZ, which act not by forming a complex with CbtA but through acting as antagonists to the CbtA toxicity, by stabilising the CbtA target proteins. For example, YeeU binds directly to both MreB and FtsZ and enhances the bundling of their filaments in vitro. YeeU is also able to neutralize the toxicity caused by other MreB and FtsZ inhibitors, such as A22 [S-(3, 4-dichlorobenzyl)isothiourea] for MreB, and SulA and DicB for FtsZ. Thus CbeA, for cytoskeleton bundling-enhancing factor A, is proposed as a general name for all of these antitoxin proteins.


:

Pssm-ID: 399275  Cd Length: 101  Bit Score: 190.34  E-value: 1.18e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 486199014    6 WGLQRAITPRLGARLVQEGNRLHYLADRASITGRFSDTECRKLDETCPHFIRHMESMLTTGELSPQHAHCVTLYHNGFTC 85
Cdd:pfam06154   3 WGLPRDITPRFGARLVQEGNRLHYLADRAGFTGSFSPEDAQQLDQAFPLLIKQLELMLLSGELNPRHQHCVTLYHNGLTC 82
                          90
                  ....*....|....*....
gi 486199014   86 EADTLGSCGYVYIAIYPTQ 104
Cdd:pfam06154  83 EADTLGSCGYVYIAIYPTQ 101
 
Name Accession Description Interval E-value
CbeA_antitoxin pfam06154
CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A; CbeA_antitoxin is a family ...
6-104 1.18e-64

CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A; CbeA_antitoxin is a family of cognate antitoxins to the CbtA toxins that act by inhibiting the polymerization of cytoskeletal proteins, see pfam06755. These are classified as a type IV toxin-antitoxin system. The family includes three proteins from E. coli YagB, YeeU and YfjZ, which act not by forming a complex with CbtA but through acting as antagonists to the CbtA toxicity, by stabilising the CbtA target proteins. For example, YeeU binds directly to both MreB and FtsZ and enhances the bundling of their filaments in vitro. YeeU is also able to neutralize the toxicity caused by other MreB and FtsZ inhibitors, such as A22 [S-(3, 4-dichlorobenzyl)isothiourea] for MreB, and SulA and DicB for FtsZ. Thus CbeA, for cytoskeleton bundling-enhancing factor A, is proposed as a general name for all of these antitoxin proteins.


Pssm-ID: 399275  Cd Length: 101  Bit Score: 190.34  E-value: 1.18e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 486199014    6 WGLQRAITPRLGARLVQEGNRLHYLADRASITGRFSDTECRKLDETCPHFIRHMESMLTTGELSPQHAHCVTLYHNGFTC 85
Cdd:pfam06154   3 WGLPRDITPRFGARLVQEGNRLHYLADRAGFTGSFSPEDAQQLDQAFPLLIKQLELMLLSGELNPRHQHCVTLYHNGLTC 82
                          90
                  ....*....|....*....
gi 486199014   86 EADTLGSCGYVYIAIYPTQ 104
Cdd:pfam06154  83 EADTLGSCGYVYIAIYPTQ 101
 
Name Accession Description Interval E-value
CbeA_antitoxin pfam06154
CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A; CbeA_antitoxin is a family ...
6-104 1.18e-64

CbeA_antitoxin, type IV, cytoskeleton bundling-enhancing factor A; CbeA_antitoxin is a family of cognate antitoxins to the CbtA toxins that act by inhibiting the polymerization of cytoskeletal proteins, see pfam06755. These are classified as a type IV toxin-antitoxin system. The family includes three proteins from E. coli YagB, YeeU and YfjZ, which act not by forming a complex with CbtA but through acting as antagonists to the CbtA toxicity, by stabilising the CbtA target proteins. For example, YeeU binds directly to both MreB and FtsZ and enhances the bundling of their filaments in vitro. YeeU is also able to neutralize the toxicity caused by other MreB and FtsZ inhibitors, such as A22 [S-(3, 4-dichlorobenzyl)isothiourea] for MreB, and SulA and DicB for FtsZ. Thus CbeA, for cytoskeleton bundling-enhancing factor A, is proposed as a general name for all of these antitoxin proteins.


Pssm-ID: 399275  Cd Length: 101  Bit Score: 190.34  E-value: 1.18e-64
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 486199014    6 WGLQRAITPRLGARLVQEGNRLHYLADRASITGRFSDTECRKLDETCPHFIRHMESMLTTGELSPQHAHCVTLYHNGFTC 85
Cdd:pfam06154   3 WGLPRDITPRFGARLVQEGNRLHYLADRAGFTGSFSPEDAQQLDQAFPLLIKQLELMLLSGELNPRHQHCVTLYHNGLTC 82
                          90
                  ....*....|....*....
gi 486199014   86 EADTLGSCGYVYIAIYPTQ 104
Cdd:pfam06154  83 EADTLGSCGYVYIAIYPTQ 101
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH