NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2462625804|ref|XP_054219473|]
View 

prorelaxin H2 isoform X3 [Homo sapiens]

Protein Classification

relaxin family protein( domain architecture ID 10137868)

relaxin family protein or peptide such as human H1 relaxin, H2 relaxin, H3 relaxin, insulin-like peptide (INSL)3, INSL4, INSL5, and INSL6; the actions of relaxin peptides are mediated by relaxin family peptide receptors (RXFPs)

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
IlGF_relaxin_like cd04365
IlGF_like family, relaxin_like subgroup, specific to vertebrates. Members include a number of ...
 31-185 2.32e-16

IlGF_like family, relaxin_like subgroup, specific to vertebrates. Members include a number of active peptides including (pro)relaxin, mammalian Leydig cell-specific insulin-like peptide (gene INSL3), early placenta insulin-like peptide (ELIP; gene INSL4), and insulin-like peptides 5 (INSL5) and 6 (INSL6). Members of this subgroup are widely expressed in testes (INSL3, INSL6), decidua, placenta, prostate, corpus luteum, brain (various relaxins), GI tract, and kidney (INSL5) where they serve a variety of functions in parturition and development. Typically, the active forms of these peptide hormones are composed of two chains (A and B) linked by two disulfide bonds; the arrangement of four cysteines is conserved in the "A" chain: Cys1 is linked by a disulfide bond to Cys3, Cys2 and Cys4 are linked by interchain disulfide bonds to cysteines in the "B" chain. This alignment contains both chains, plus the intervening linker region, arranged as found in the propeptide form. Propeptides are cleaved to yield two separate chains linked covalently by the two disulfide bonds.


:

Pssm-ID: 239831  Cd Length: 59  Bit Score: 69.66  E-value: 2.32e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2462625804  31 VIKLCGRELVRAQIAICGMSTWSKrslsqedapqtprpvaeivpsfinkdtetinmmsefvanlpqelkltlsemqpalp 110
Cdd:cd04365     1 VVKLCGRELVRAVIEICGGSRWRR-------------------------------------------------------- 24

                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2462625804 111 qlqqhvpvlkdssllfeefkklirnrqseaadsspselkyLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC 185
Cdd:cd04365    25 ----------------------------------------LGLDTHSRKKRQFSRGLSEKCCKVGCTKEELAKLC 59
 
Name Accession Description Interval E-value
IlGF_relaxin_like cd04365
IlGF_like family, relaxin_like subgroup, specific to vertebrates. Members include a number of ...
 31-185 2.32e-16

IlGF_like family, relaxin_like subgroup, specific to vertebrates. Members include a number of active peptides including (pro)relaxin, mammalian Leydig cell-specific insulin-like peptide (gene INSL3), early placenta insulin-like peptide (ELIP; gene INSL4), and insulin-like peptides 5 (INSL5) and 6 (INSL6). Members of this subgroup are widely expressed in testes (INSL3, INSL6), decidua, placenta, prostate, corpus luteum, brain (various relaxins), GI tract, and kidney (INSL5) where they serve a variety of functions in parturition and development. Typically, the active forms of these peptide hormones are composed of two chains (A and B) linked by two disulfide bonds; the arrangement of four cysteines is conserved in the "A" chain: Cys1 is linked by a disulfide bond to Cys3, Cys2 and Cys4 are linked by interchain disulfide bonds to cysteines in the "B" chain. This alignment contains both chains, plus the intervening linker region, arranged as found in the propeptide form. Propeptides are cleaved to yield two separate chains linked covalently by the two disulfide bonds.


Pssm-ID: 239831  Cd Length: 59  Bit Score: 69.66  E-value: 2.32e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2462625804  31 VIKLCGRELVRAQIAICGMSTWSKrslsqedapqtprpvaeivpsfinkdtetinmmsefvanlpqelkltlsemqpalp 110
Cdd:cd04365     1 VVKLCGRELVRAVIEICGGSRWRR-------------------------------------------------------- 24

                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2462625804 111 qlqqhvpvlkdssllfeefkklirnrqseaadsspselkyLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC 185
Cdd:cd04365    25 ----------------------------------------LGLDTHSRKKRQFSRGLSEKCCKVGCTKEELAKLC 59
IlGF smart00078
Insulin / insulin-like growth factor / relaxin family; Family of proteins including insulin, ...
 32-71 2.20e-08

Insulin / insulin-like growth factor / relaxin family; Family of proteins including insulin, relaxin, and IGFs. Insulin decreases blood glucose concentration.


Pssm-ID: 214506  Cd Length: 66  Bit Score: 48.96  E-value: 2.20e-08
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 2462625804   32 IKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAE 71
Cdd:smart00078   1 QHLCGRHLVRALYLVCGERGFFYSPKSRRYAPYGQVPPLE 40
Insulin pfam00049
Insulin/IGF/Relaxin family; Superfamily includes insulins; relaxins; insulin-like growth ...
 32-185 2.29e-08

Insulin/IGF/Relaxin family; Superfamily includes insulins; relaxins; insulin-like growth factor; and bombyxin. All are secreted regulatory hormones. Disulfide rich, all-alpha fold. Alignment includes B chain, linker (which is processed out of the final product), and A chain.


Pssm-ID: 459651  Cd Length: 77  Bit Score: 49.01  E-value: 2.29e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2462625804  32 IKLCGRELVRAQIAICGMStwskrsLSQEDAPQTPRPVAEIVPsfinkdtetinmmsefvanlpqelkltlsemqpalpq 111
Cdd:pfam00049   1 QHLCGRHLVRALYLVCGDR------GFFYAPKPREDPQVEQLP------------------------------------- 37

                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 2462625804 112 lqqhvpvlkdssllfeefkklirnrqseaaDSSPSELKYLGLDTHSRKKRqlysALANKCCHVGCTKRSLARFC 185
Cdd:pfam00049  38 ------------------------------DGEGAELKYLGADEHSRRKR----GIVEECCHRPCTLDQLESYC 77
 
Name Accession Description Interval E-value
IlGF_relaxin_like cd04365
IlGF_like family, relaxin_like subgroup, specific to vertebrates. Members include a number of ...
 31-185 2.32e-16

IlGF_like family, relaxin_like subgroup, specific to vertebrates. Members include a number of active peptides including (pro)relaxin, mammalian Leydig cell-specific insulin-like peptide (gene INSL3), early placenta insulin-like peptide (ELIP; gene INSL4), and insulin-like peptides 5 (INSL5) and 6 (INSL6). Members of this subgroup are widely expressed in testes (INSL3, INSL6), decidua, placenta, prostate, corpus luteum, brain (various relaxins), GI tract, and kidney (INSL5) where they serve a variety of functions in parturition and development. Typically, the active forms of these peptide hormones are composed of two chains (A and B) linked by two disulfide bonds; the arrangement of four cysteines is conserved in the "A" chain: Cys1 is linked by a disulfide bond to Cys3, Cys2 and Cys4 are linked by interchain disulfide bonds to cysteines in the "B" chain. This alignment contains both chains, plus the intervening linker region, arranged as found in the propeptide form. Propeptides are cleaved to yield two separate chains linked covalently by the two disulfide bonds.


Pssm-ID: 239831  Cd Length: 59  Bit Score: 69.66  E-value: 2.32e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2462625804  31 VIKLCGRELVRAQIAICGMSTWSKrslsqedapqtprpvaeivpsfinkdtetinmmsefvanlpqelkltlsemqpalp 110
Cdd:cd04365     1 VVKLCGRELVRAVIEICGGSRWRR-------------------------------------------------------- 24

                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2462625804 111 qlqqhvpvlkdssllfeefkklirnrqseaadsspselkyLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC 185
Cdd:cd04365    25 ----------------------------------------LGLDTHSRKKRQFSRGLSEKCCKVGCTKEELAKLC 59
IlGF smart00078
Insulin / insulin-like growth factor / relaxin family; Family of proteins including insulin, ...
 32-71 2.20e-08

Insulin / insulin-like growth factor / relaxin family; Family of proteins including insulin, relaxin, and IGFs. Insulin decreases blood glucose concentration.


Pssm-ID: 214506  Cd Length: 66  Bit Score: 48.96  E-value: 2.20e-08
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 2462625804   32 IKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAE 71
Cdd:smart00078   1 QHLCGRHLVRALYLVCGERGFFYSPKSRRYAPYGQVPPLE 40
Insulin pfam00049
Insulin/IGF/Relaxin family; Superfamily includes insulins; relaxins; insulin-like growth ...
 32-185 2.29e-08

Insulin/IGF/Relaxin family; Superfamily includes insulins; relaxins; insulin-like growth factor; and bombyxin. All are secreted regulatory hormones. Disulfide rich, all-alpha fold. Alignment includes B chain, linker (which is processed out of the final product), and A chain.


Pssm-ID: 459651  Cd Length: 77  Bit Score: 49.01  E-value: 2.29e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2462625804  32 IKLCGRELVRAQIAICGMStwskrsLSQEDAPQTPRPVAEIVPsfinkdtetinmmsefvanlpqelkltlsemqpalpq 111
Cdd:pfam00049   1 QHLCGRHLVRALYLVCGDR------GFFYAPKPREDPQVEQLP------------------------------------- 37

                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 2462625804 112 lqqhvpvlkdssllfeefkklirnrqseaaDSSPSELKYLGLDTHSRKKRqlysALANKCCHVGCTKRSLARFC 185
Cdd:pfam00049  38 ------------------------------DGEGAELKYLGADEHSRRKR----GIVEECCHRPCTLDQLESYC 77
IlGF_like cd00101
Insulin/insulin-like growth factor/relaxin family; insulin family of proteins. Members include ...
 34-60 2.46e-04

Insulin/insulin-like growth factor/relaxin family; insulin family of proteins. Members include a number of active peptides which are evolutionary related including insulin, relaxin, prorelaxin, insulin-like growth factors I and II, mammalian Leydig cell-specific insulin-like peptide (gene INSL3), early placenta insulin-like peptide (ELIP; gene INSL4), insect prothoracicotropic hormone (bombyxin), locust insulin-related peptide (LIRP), molluscan insulin-related peptides 1 to 5 (MIP), and C. elegans insulin-like peptides. Typically, the active forms of these peptide hormones are composed of two chains (A and B) linked by two disulfide bonds; the arrangement of four cysteines is conserved in the "A" chain: Cys1 is linked by a disulfide bond to Cys3, Cys2 and Cys4 are linked by interchain disulfide bonds to cysteines in the "B" chain. This alignment contains both chains, plus the intervening linker region, arranged as found in the propeptide form. Propeptides are cleaved to yield two separate chains linked covalently by the two disulfide bonds.


Pssm-ID: 238049  Cd Length: 41  Bit Score: 37.22  E-value: 2.46e-04
                          10        20
                  ....*....|....*....|....*..
gi 2462625804  34 LCGRELVRAQIAICGMSTWsKRSLSQE 60
Cdd:cd00101     1 LCGRELVRALIFVCGDRGF-YRGIVDE 26
IlGF_like cd00101
Insulin/insulin-like growth factor/relaxin family; insulin family of proteins. Members include ...
 167-185 2.60e-03

Insulin/insulin-like growth factor/relaxin family; insulin family of proteins. Members include a number of active peptides which are evolutionary related including insulin, relaxin, prorelaxin, insulin-like growth factors I and II, mammalian Leydig cell-specific insulin-like peptide (gene INSL3), early placenta insulin-like peptide (ELIP; gene INSL4), insect prothoracicotropic hormone (bombyxin), locust insulin-related peptide (LIRP), molluscan insulin-related peptides 1 to 5 (MIP), and C. elegans insulin-like peptides. Typically, the active forms of these peptide hormones are composed of two chains (A and B) linked by two disulfide bonds; the arrangement of four cysteines is conserved in the "A" chain: Cys1 is linked by a disulfide bond to Cys3, Cys2 and Cys4 are linked by interchain disulfide bonds to cysteines in the "B" chain. This alignment contains both chains, plus the intervening linker region, arranged as found in the propeptide form. Propeptides are cleaved to yield two separate chains linked covalently by the two disulfide bonds.


Pssm-ID: 238049  Cd Length: 41  Bit Score: 34.53  E-value: 2.60e-03
                          10
                  ....*....|....*....
gi 2462625804 167 LANKCCHVGCTKRSLARFC 185
Cdd:cd00101    23 IVDECCFRGCTLRELASYC 41
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH