NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2781192759|ref|XP_066608756|]
View 

uncharacterized protein I312_104858 [Cryptococcus bacillisporus CA1280]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
API5 super family cl09392
Apoptosis inhibitory protein 5 (API5); This family consists of apoptosis inhibitory protein 5 ...
 53-164 1.94e-11

Apoptosis inhibitory protein 5 (API5); This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organizms. Apoptosis or programmed cell death is a physiological form of cell death that occurs in embryonic development and organ formation. It is characterized by biochemical and morphological changes such as DNA fragmentation and cell volume shrinkage. API5 is an anti apoptosis gene located in human chromosome 11, whose expression prevents the programmed cell death that occurs upon the deprivation of growth factors and is up-regulated in various cancer cells. This protein has an elongated all alpha-helical structure, in which the N-terminal half is similar to the HEAT repeat and the C-terminal half is similar to the ARM (Armadillo-like) repeat. This suggests that API5 is involved in protein-protein interactions and may act as a scaffold for multiprotein complexes.


The actual alignment was detected with superfamily member pfam05918:

Pssm-ID: 428672 [Multi-domain]  Cd Length: 532  Bit Score: 67.79  E-value: 1.94e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2781192759  53 LVHKFFAEFEDLQDAAIDALLDLCEDEDEKVRMIGIRALGPTARADPRWVRGNTGVLLQLLASQDQ-ELKYVRESIHTLL 131
Cdd:pfam05918  45 FIPKFFKFFPSLANTAIDAQLDLCEDDDLGVRVQAIKGLPLLCKDNPEYVPKIVDILGQLLNTEDPvERDAVHKALMSLL 124

                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 2781192759 132 AVSPAD----VFSVMaddcrGSEEETgaSRQNILKFL 164
Cdd:pfam05918 125 KQDTKAsltgLFKQI-----ETGDET--VREKVLKFI 154
 
Name Accession Description Interval E-value
API5 pfam05918
Apoptosis inhibitory protein 5 (API5); This family consists of apoptosis inhibitory protein 5 ...
 53-164 1.94e-11

Apoptosis inhibitory protein 5 (API5); This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organizms. Apoptosis or programmed cell death is a physiological form of cell death that occurs in embryonic development and organ formation. It is characterized by biochemical and morphological changes such as DNA fragmentation and cell volume shrinkage. API5 is an anti apoptosis gene located in human chromosome 11, whose expression prevents the programmed cell death that occurs upon the deprivation of growth factors and is up-regulated in various cancer cells. This protein has an elongated all alpha-helical structure, in which the N-terminal half is similar to the HEAT repeat and the C-terminal half is similar to the ARM (Armadillo-like) repeat. This suggests that API5 is involved in protein-protein interactions and may act as a scaffold for multiprotein complexes.


Pssm-ID: 428672 [Multi-domain]  Cd Length: 532  Bit Score: 67.79  E-value: 1.94e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2781192759  53 LVHKFFAEFEDLQDAAIDALLDLCEDEDEKVRMIGIRALGPTARADPRWVRGNTGVLLQLLASQDQ-ELKYVRESIHTLL 131
Cdd:pfam05918  45 FIPKFFKFFPSLANTAIDAQLDLCEDDDLGVRVQAIKGLPLLCKDNPEYVPKIVDILGQLLNTEDPvERDAVHKALMSLL 124

                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 2781192759 132 AVSPAD----VFSVMaddcrGSEEETgaSRQNILKFL 164
Cdd:pfam05918 125 KQDTKAsltgLFKQI-----ETGDET--VREKVLKFI 154
 
Name Accession Description Interval E-value
API5 pfam05918
Apoptosis inhibitory protein 5 (API5); This family consists of apoptosis inhibitory protein 5 ...
 53-164 1.94e-11

Apoptosis inhibitory protein 5 (API5); This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organizms. Apoptosis or programmed cell death is a physiological form of cell death that occurs in embryonic development and organ formation. It is characterized by biochemical and morphological changes such as DNA fragmentation and cell volume shrinkage. API5 is an anti apoptosis gene located in human chromosome 11, whose expression prevents the programmed cell death that occurs upon the deprivation of growth factors and is up-regulated in various cancer cells. This protein has an elongated all alpha-helical structure, in which the N-terminal half is similar to the HEAT repeat and the C-terminal half is similar to the ARM (Armadillo-like) repeat. This suggests that API5 is involved in protein-protein interactions and may act as a scaffold for multiprotein complexes.


Pssm-ID: 428672 [Multi-domain]  Cd Length: 532  Bit Score: 67.79  E-value: 1.94e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2781192759  53 LVHKFFAEFEDLQDAAIDALLDLCEDEDEKVRMIGIRALGPTARADPRWVRGNTGVLLQLLASQDQ-ELKYVRESIHTLL 131
Cdd:pfam05918  45 FIPKFFKFFPSLANTAIDAQLDLCEDDDLGVRVQAIKGLPLLCKDNPEYVPKIVDILGQLLNTEDPvERDAVHKALMSLL 124

                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 2781192759 132 AVSPAD----VFSVMaddcrGSEEETgaSRQNILKFL 164
Cdd:pfam05918 125 KQDTKAsltgLFKQI-----ETGDET--VREKVLKFI 154
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH