NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|51467986|ref|NP_001003869|]
View 

F-box only protein 5 [Danio rerio]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
F-box_FBXO5 cd22170
F-box domain found in F-box only protein 5 (FBXO5) and similar proteins; FBXO5, also called ...
187-235 1.03e-21

F-box domain found in F-box only protein 5 (FBXO5) and similar proteins; FBXO5, also called FBX5, or early mitotic inhibitor 1 (EMI1), acts as a regulator that inhibits the anaphase-promoting complex/cyclosome (APC/C), which controls cell cycle progression through the sequential degradation of various substrates from S phase to early mitosis. During mitotic cell cycle, it plays a role as both substrate and inhibitor of the APC-FZR1 complex. During G1 phase, it plays a role as substrate of the APC-FZR1 complex E3 ligase. The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression.


:

Pssm-ID: 438941  Cd Length: 49  Bit Score: 87.09  E-value: 1.03e-21
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*....
gi 51467986 187 CKLMRKDMRHILARILGLLADCDLISCTKVSRTWRKIICQDQLALQRWK 235
Cdd:cd22170   1 AELFLRDLKHVLAKILRHLSDMDLINCSKVSTTWRKILQEDKWAFQIYS 49
BRcat_RBR_EMI cd20348
BRcat domain found in early mitotic inhibitor (EMI) subfamily of F-box proteins; The EMI ...
309-357 6.37e-19

BRcat domain found in early mitotic inhibitor (EMI) subfamily of F-box proteins; The EMI subfamily includes FBXO5 (EMI1) and FBXO43 (EMI2), which are anaphase-promoting-complex/cyclosome (APC/C) inhibitors that bind APC/C-CCD20 (Cell division cycle protein 20) and/or APC/C-CDH1 (CDC20 homolog 1) complexes. FBXO5, also called FBX5, or early mitotic inhibitor 1 (EMI1), acts as a regulator that inhibits the anaphase-promoting complex/cyclosome (APC/C), which controls cell cycle progression through the sequential degradation of various substrates from S phase to early mitosis. During the mitotic cell cycle, it plays a role as both substrate and inhibitor of the APC-FZR1 complex. During G1 phase, it plays a role as substrate of the APC-FZR1 complex E3 ligase. FBXO43, also called FBX43, or endogenous meiotic inhibitor 2 (EMI2), plays a key role during the meiotic cell cycle. It is required to establish and maintain the arrest of oocytes at the second meiotic metaphase until fertilization. It probably acts by inhibiting the APC/C ubiquitin ligase. It may recognize and bind to some phosphorylated proteins and promote their ubiquitination and degradation. Both FBXO5 and FBXO43 contain an F-box domain, and the first half of the RBR domain that was previously known as RING-BetweenRING-RING domain or TRIAD [two RING fingers and a DRIL (double RING finger linked)] domain. Based on current understanding of the structural biology of RBR ligases, the nomenclature of RBR has been changed to RING1-BRcat (benign-catalytic)-Rcat (required-for-catalysis) recently. The RBR domain uses an auto-inhibitory mechanism to modulate ubiquitination activity, as well as a hybrid mechanism that combines aspects from both RING and HECT E3 ligase functions to facilitate the ubiquitination reaction. This model corresponds to the BRcat domain of the EMI subfamily that adopts the same fold as the Rcat domain while lacking the catalytic cysteine residue and ubiquitination activity.


:

Pssm-ID: 439009  Cd Length: 51  Bit Score: 79.32  E-value: 6.37e-19
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*....
gi 51467986 309 HESLRRCSRCSSPARFDAVMQRAVCTRISCAFEFCTLCQSAFHDSNPCR 357
Cdd:cd20348   1 GESLRPCPRCSSPAKVDPVEQRATCTRETCGFDFCTKCLCEFHGSKPCP 49
 
Name Accession Description Interval E-value
F-box_FBXO5 cd22170
F-box domain found in F-box only protein 5 (FBXO5) and similar proteins; FBXO5, also called ...
187-235 1.03e-21

F-box domain found in F-box only protein 5 (FBXO5) and similar proteins; FBXO5, also called FBX5, or early mitotic inhibitor 1 (EMI1), acts as a regulator that inhibits the anaphase-promoting complex/cyclosome (APC/C), which controls cell cycle progression through the sequential degradation of various substrates from S phase to early mitosis. During mitotic cell cycle, it plays a role as both substrate and inhibitor of the APC-FZR1 complex. During G1 phase, it plays a role as substrate of the APC-FZR1 complex E3 ligase. The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression.


Pssm-ID: 438941  Cd Length: 49  Bit Score: 87.09  E-value: 1.03e-21
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*....
gi 51467986 187 CKLMRKDMRHILARILGLLADCDLISCTKVSRTWRKIICQDQLALQRWK 235
Cdd:cd22170   1 AELFLRDLKHVLAKILRHLSDMDLINCSKVSTTWRKILQEDKWAFQIYS 49
BRcat_RBR_EMI cd20348
BRcat domain found in early mitotic inhibitor (EMI) subfamily of F-box proteins; The EMI ...
309-357 6.37e-19

BRcat domain found in early mitotic inhibitor (EMI) subfamily of F-box proteins; The EMI subfamily includes FBXO5 (EMI1) and FBXO43 (EMI2), which are anaphase-promoting-complex/cyclosome (APC/C) inhibitors that bind APC/C-CCD20 (Cell division cycle protein 20) and/or APC/C-CDH1 (CDC20 homolog 1) complexes. FBXO5, also called FBX5, or early mitotic inhibitor 1 (EMI1), acts as a regulator that inhibits the anaphase-promoting complex/cyclosome (APC/C), which controls cell cycle progression through the sequential degradation of various substrates from S phase to early mitosis. During the mitotic cell cycle, it plays a role as both substrate and inhibitor of the APC-FZR1 complex. During G1 phase, it plays a role as substrate of the APC-FZR1 complex E3 ligase. FBXO43, also called FBX43, or endogenous meiotic inhibitor 2 (EMI2), plays a key role during the meiotic cell cycle. It is required to establish and maintain the arrest of oocytes at the second meiotic metaphase until fertilization. It probably acts by inhibiting the APC/C ubiquitin ligase. It may recognize and bind to some phosphorylated proteins and promote their ubiquitination and degradation. Both FBXO5 and FBXO43 contain an F-box domain, and the first half of the RBR domain that was previously known as RING-BetweenRING-RING domain or TRIAD [two RING fingers and a DRIL (double RING finger linked)] domain. Based on current understanding of the structural biology of RBR ligases, the nomenclature of RBR has been changed to RING1-BRcat (benign-catalytic)-Rcat (required-for-catalysis) recently. The RBR domain uses an auto-inhibitory mechanism to modulate ubiquitination activity, as well as a hybrid mechanism that combines aspects from both RING and HECT E3 ligase functions to facilitate the ubiquitination reaction. This model corresponds to the BRcat domain of the EMI subfamily that adopts the same fold as the Rcat domain while lacking the catalytic cysteine residue and ubiquitination activity.


Pssm-ID: 439009  Cd Length: 51  Bit Score: 79.32  E-value: 6.37e-19
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*....
gi 51467986 309 HESLRRCSRCSSPARFDAVMQRAVCTRISCAFEFCTLCQSAFHDSNPCR 357
Cdd:cd20348   1 GESLRPCPRCSSPAKVDPVEQRATCTRETCGFDFCTKCLCEFHGSKPCP 49
F-box-like pfam12937
F-box-like; This is an F-box-like family.
197-236 8.08e-05

F-box-like; This is an F-box-like family.


Pssm-ID: 463757 [Multi-domain]  Cd Length: 45  Bit Score: 39.77  E-value: 8.08e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 51467986   197 ILARILGLLADCDLISCTKVSRTWRKIICQDQLalqrWKK 236
Cdd:pfam12937   8 ILLQIFSYLDPKDLLRLALVCRRWRELASDDSL----WRR 43
 
Name Accession Description Interval E-value
F-box_FBXO5 cd22170
F-box domain found in F-box only protein 5 (FBXO5) and similar proteins; FBXO5, also called ...
187-235 1.03e-21

F-box domain found in F-box only protein 5 (FBXO5) and similar proteins; FBXO5, also called FBX5, or early mitotic inhibitor 1 (EMI1), acts as a regulator that inhibits the anaphase-promoting complex/cyclosome (APC/C), which controls cell cycle progression through the sequential degradation of various substrates from S phase to early mitosis. During mitotic cell cycle, it plays a role as both substrate and inhibitor of the APC-FZR1 complex. During G1 phase, it plays a role as substrate of the APC-FZR1 complex E3 ligase. The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression.


Pssm-ID: 438941  Cd Length: 49  Bit Score: 87.09  E-value: 1.03e-21
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*....
gi 51467986 187 CKLMRKDMRHILARILGLLADCDLISCTKVSRTWRKIICQDQLALQRWK 235
Cdd:cd22170   1 AELFLRDLKHVLAKILRHLSDMDLINCSKVSTTWRKILQEDKWAFQIYS 49
BRcat_RBR_EMI cd20348
BRcat domain found in early mitotic inhibitor (EMI) subfamily of F-box proteins; The EMI ...
309-357 6.37e-19

BRcat domain found in early mitotic inhibitor (EMI) subfamily of F-box proteins; The EMI subfamily includes FBXO5 (EMI1) and FBXO43 (EMI2), which are anaphase-promoting-complex/cyclosome (APC/C) inhibitors that bind APC/C-CCD20 (Cell division cycle protein 20) and/or APC/C-CDH1 (CDC20 homolog 1) complexes. FBXO5, also called FBX5, or early mitotic inhibitor 1 (EMI1), acts as a regulator that inhibits the anaphase-promoting complex/cyclosome (APC/C), which controls cell cycle progression through the sequential degradation of various substrates from S phase to early mitosis. During the mitotic cell cycle, it plays a role as both substrate and inhibitor of the APC-FZR1 complex. During G1 phase, it plays a role as substrate of the APC-FZR1 complex E3 ligase. FBXO43, also called FBX43, or endogenous meiotic inhibitor 2 (EMI2), plays a key role during the meiotic cell cycle. It is required to establish and maintain the arrest of oocytes at the second meiotic metaphase until fertilization. It probably acts by inhibiting the APC/C ubiquitin ligase. It may recognize and bind to some phosphorylated proteins and promote their ubiquitination and degradation. Both FBXO5 and FBXO43 contain an F-box domain, and the first half of the RBR domain that was previously known as RING-BetweenRING-RING domain or TRIAD [two RING fingers and a DRIL (double RING finger linked)] domain. Based on current understanding of the structural biology of RBR ligases, the nomenclature of RBR has been changed to RING1-BRcat (benign-catalytic)-Rcat (required-for-catalysis) recently. The RBR domain uses an auto-inhibitory mechanism to modulate ubiquitination activity, as well as a hybrid mechanism that combines aspects from both RING and HECT E3 ligase functions to facilitate the ubiquitination reaction. This model corresponds to the BRcat domain of the EMI subfamily that adopts the same fold as the Rcat domain while lacking the catalytic cysteine residue and ubiquitination activity.


Pssm-ID: 439009  Cd Length: 51  Bit Score: 79.32  E-value: 6.37e-19
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*....
gi 51467986 309 HESLRRCSRCSSPARFDAVMQRAVCTRISCAFEFCTLCQSAFHDSNPCR 357
Cdd:cd20348   1 GESLRPCPRCSSPAKVDPVEQRATCTRETCGFDFCTKCLCEFHGSKPCP 49
BRcat_RBR_FBXO5 cd20364
BRcat domain found in F-box only protein 5 (FBXO5); FBXO5, also called FBX5 or early mitotic ...
306-358 1.54e-14

BRcat domain found in F-box only protein 5 (FBXO5); FBXO5, also called FBX5 or early mitotic inhibitor 1 (EMI1), acts as a regulator that inhibits the anaphase-promoting complex/cyclosome (APC/C), which controls cell cycle progression through the sequential degradation of various substrates from S phase to early mitosis. During mitotic cell cycle, it plays a role as both substrate and inhibitor of the APC-FZR1 complex. During G1 phase, it plays a role as substrate of the APC-FZR1 complex E3 ligase. FBXO5 contains an F-box domain, and the first half of the RBR domain that was previously known as RING-BetweenRING-RING domain or TRIAD [two RING fingers and a DRIL (double RING finger linked)] domain. Based on current understanding of the structural biology of RBR ligases, the nomenclature of RBR has been changed to RING1-BRcat (benign-catalytic)-Rcat (required-for-catalysis) recently. The RBR domain uses an auto-inhibitory mechanism to modulate ubiquitination activity, as well as a hybrid mechanism that combines aspects from both RING and HECT E3 ligase functions to facilitate the ubiquitination reaction. This model corresponds to the BRcat domain of FBXO5 that adopts the same fold as the Rcat domain while lacking the catalytic cysteine residue and ubiquitination activity.


Pssm-ID: 439025  Cd Length: 57  Bit Score: 67.51  E-value: 1.54e-14
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|...
gi 51467986 306 LKQHESLRRCSRCSSPARFDAVMQRAVCTRISCAFEFCTLCQSAFHDSNPCRN 358
Cdd:cd20364   1 LKNDESLKACVRCNSPAKYDPYLQRATCTRESCGFDFCTKCLCKYHGSKDCLN 53
BRcat_RBR_FBXO43 cd20365
BRcat domain found in F-box only protein 43 (FBXO43); FBXO43, also called FBX43 or endogenous ...
310-357 1.56e-11

BRcat domain found in F-box only protein 43 (FBXO43); FBXO43, also called FBX43 or endogenous meiotic inhibitor 2 (EMI2), plays a key role during the meiotic cell cycle. It is required to establish and maintain the arrest of oocytes at the second meiotic metaphase until fertilization. It probably acts by inhibiting the anaphase-promoting complex/cyclosome (APC/C) ubiquitin ligase. It may recognize and bind to some phosphorylated proteins and promotes their ubiquitination and degradation. FBXO43 contains an F-box domain, and the first half of the RBR domain that was previously known as RING-BetweenRING-RING domain or TRIAD [two RING fingers and a DRIL (double RING finger linked)] domain. Based on current understanding of the structural biology of RBR ligases, the nomenclature of RBR has been changed to RING1-BRcat (benign-catalytic)-Rcat (required-for-catalysis) recently. The RBR domain uses an auto-inhibitory mechanism to modulate ubiquitination activity, as well as a hybrid mechanism that combines aspects from both RING and HECT E3 ligase functions to facilitate the ubiquitination reaction. This model corresponds to the BRcat (benign-catalytic) domain that adopts the same fold as the Rcat domain while lacking the catalytic cysteine residue and ubiquitination activity.


Pssm-ID: 439026  Cd Length: 51  Bit Score: 59.04  E-value: 1.56e-11
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*...
gi 51467986 310 ESLRRCSRCSSPARFDAVMQRAVCTRISCAFEFCTLCQSAFHDSNPCR 357
Cdd:cd20365   2 EALKPCPRCQSPAKYQPVKKRGLCSREACGFDFCVLCLCAFHGSKECT 49
F-box_FBXO43 cd22171
F-box domain found in F-box only protein 43 (FBXO43) and similar proteins; FBXO43, also called ...
189-235 1.52e-07

F-box domain found in F-box only protein 43 (FBXO43) and similar proteins; FBXO43, also called FBX43, or endogenous meiotic inhibitor 2 (EMI2), plays a key role during the meiotic cell cycle. It is required to establish and maintain the arrest of oocytes at the second meiotic metaphase until fertilization. It probably acts by inhibiting the anaphase-promoting complex/cyclosome (APC/C) ubiquitin ligase. It may recognize and bind to some phosphorylated proteins and promote their ubiquitination and degradation. The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression.


Pssm-ID: 438942  Cd Length: 49  Bit Score: 47.47  E-value: 1.52e-07
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*..
gi 51467986 189 LMRKDMRHILARILGLLADCDLISCTKVSRTWRKIICQDQLALQRWK 235
Cdd:cd22171   3 LKNRNLKHILAIILDLLTAESICSFWKVSKNWRDIIVQDKSAYQRRK 49
F-box_EMI cd22086
F-box domain found in the early mitotic inhibitor (EMI) family of F-box proteins; The EMI ...
189-234 3.25e-06

F-box domain found in the early mitotic inhibitor (EMI) family of F-box proteins; The EMI family includes FBX5 (EMI1) and FBX43 (EMI2), which are anaphase-promoting complex/cyclosome (APC/C) inhibitors that bind APC/C-CCD20 (Cell division cycle protein 20) and/or APC/C-CDH1 (CDC20 homologue 1) complexes. The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression.


Pssm-ID: 438858  Cd Length: 48  Bit Score: 43.64  E-value: 3.25e-06
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*.
gi 51467986 189 LMRKDMRHILARILGLLADCDLISCTKVSRTWRKIICQDQLALQRW 234
Cdd:cd22086   3 LHKRNCPHILSKILSYLSPEDLCRVSCVSKTWRQICLSDPKANRRR 48
F-box-like pfam12937
F-box-like; This is an F-box-like family.
197-236 8.08e-05

F-box-like; This is an F-box-like family.


Pssm-ID: 463757 [Multi-domain]  Cd Length: 45  Bit Score: 39.77  E-value: 8.08e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 51467986   197 ILARILGLLADCDLISCTKVSRTWRKIICQDQLalqrWKK 236
Cdd:pfam12937   8 ILLQIFSYLDPKDLLRLALVCRRWRELASDDSL----WRR 43
BRcat_RBR_RNF14 cd20341
BRcat domain found in RING finger protein 14 (RNF14); RNF14, also called androgen receptor (AR) ...
315-357 1.81e-03

BRcat domain found in RING finger protein 14 (RNF14); RNF14, also called androgen receptor (AR)-associated protein 54 (ARA54), HFB30, or Triad2 protein, is an RBR-type E3 ubiquitin-protein ligase that is highly expressed in the testis and interacts with class III E2s (UBE2E2, UbcH6, and UBE2E3). Its differential localization may play an important role in testicular development and spermatogenesis in humans. RNF14 functions as a transcriptional regulator of mitochondrial and immune function in muscles. It is a ligand-dependent AR co-activator that enhances AR-dependent transcriptional activation. It may also participate in enhancing cell cycle progression and cell proliferation via induction of cyclin D1. Moreover, RNF14 is crucial for colon cancer cell survival. It acts as a new enhancer of the Wnt-dependent transcriptional outputs that acts at the level of the T-cell factor/lymphoid enhancer factor (TCF/LEF)-beta-catenin complex. RNF14 contains an N-terminal RWD domain, and a C-terminal RBR domain. The RBR domain was previously known as RING-BetweenRING-RING domain or TRIAD [two RING fingers and a DRIL (double RING finger linked)] domain. Based on current understanding of the structural biology of RBR ligases, the nomenclature of RBR has been changed to RING1-BRcat (benign-catalytic)-Rcat (required-for-catalysis) recently. The RBR domain uses an auto-inhibitory mechanism to modulate ubiquitination activity, as well as a hybrid mechanism that combines aspects from both RING and HECT E3 ligase function to facilitate the ubiquitination reaction. This model corresponds to the BRcat domain of RNF14 that adopts the same fold as the Rcat domain while lacking the catalytic cysteine residue and ubiquitination activity.


Pssm-ID: 439002  Cd Length: 57  Bit Score: 36.13  E-value: 1.81e-03
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*
gi 51467986 315 CSR--CSSPARFDAVMQRAVCTriSCAFEFCTLCQSAFHDSNPCR 357
Cdd:cd20341  10 CPRpsCQTPVILEPDENLGICP--SCNYAFCTLCRETYHGVSPCK 52
F-box_SF cd09917
F-box domain superfamily; This short domain is commonly found at the N-terminus of various ...
196-225 5.68e-03

F-box domain superfamily; This short domain is commonly found at the N-terminus of various proteins, and typically co-occurs with one or more other conserved domains or motifs, such as leucine rich repeats, WD40 repeats, kelch, tub, spry, and others. The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. One of the best researched roles of F-box proteins is their participation in SCF (Skp1-Cul1-F-box protein), a multi-protein complex that functions as a ubiquitin E3 ligase, where the role of the F-box protein is to recruit target substrates. Gene families containing the F-box are found greatly expanded in narrow taxonomic lineages, such as flowering plants and nematodes. In this hierarchical classification, many of the subfamilies are named according to their domain architectures.


Pssm-ID: 438852  Cd Length: 35  Bit Score: 34.34  E-value: 5.68e-03
                        10        20        30
                ....*....|....*....|....*....|
gi 51467986 196 HILARILGLLADCDLISCTKVSRTWRKIIC 225
Cdd:cd09917   6 EILLKILSYLDPRDLLRLSLVCKRWRELAS 35
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH