NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|116325977|ref|NP_001028190|]
View 

defensin beta 136 precursor [Homo sapiens]

Protein Classification

DEFB136 domain-containing protein( domain architecture ID 13879699)

DEFB136 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DEFB136 pfam17333
Beta defensin 136; Beta-defensins are small cationic peptides that have triple-stranded ...
25-75 2.75e-28

Beta defensin 136; Beta-defensins are small cationic peptides that have triple-stranded beta-sheet structure. They are characterized by the presence of multiple cysteine residues (forming three distinctive intramolecular disulfide bridges) and a highly similar tertiary structure known as the defensin motif. All beta-defensin genes encode a precursor peptide that consists of a hydrophobic, leucine-rich signal sequence, a pro-sequence, and a mature six-cysteine defensin motif at the carboxy terminus. They exhibit broad-spectrum antimicrobial properties and contribute to mucosal immune responses at epithelial sites. Several beta-defensins family members have been shown to play essential roles in sperm maturation and fertility in rats, mice and humans. In addition to the wide spectrum of antimicrobial activity, mammalian beta-defensins have been reported to have other roles in the immune system, such as the chemotactic ability for immature dendritic cells and memory T-cells via chemokine receptor-6 demonstrated by human beta-defensin-2. This entry contains beta-defensins such as DEFB136, the mouse homolog Defb42 and Ostricacin-3.


:

Pssm-ID: 375136  Cd Length: 51  Bit Score: 95.99  E-value: 2.75e-28
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 116325977  25 NDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP 75
Cdd:pfam17333  1 NDGVSVRTCTALGGLCFFGCKPGWKWVAFCHNILSCCKKDTKFKPPQAKEP 51
 
Name Accession Description Interval E-value
DEFB136 pfam17333
Beta defensin 136; Beta-defensins are small cationic peptides that have triple-stranded ...
25-75 2.75e-28

Beta defensin 136; Beta-defensins are small cationic peptides that have triple-stranded beta-sheet structure. They are characterized by the presence of multiple cysteine residues (forming three distinctive intramolecular disulfide bridges) and a highly similar tertiary structure known as the defensin motif. All beta-defensin genes encode a precursor peptide that consists of a hydrophobic, leucine-rich signal sequence, a pro-sequence, and a mature six-cysteine defensin motif at the carboxy terminus. They exhibit broad-spectrum antimicrobial properties and contribute to mucosal immune responses at epithelial sites. Several beta-defensins family members have been shown to play essential roles in sperm maturation and fertility in rats, mice and humans. In addition to the wide spectrum of antimicrobial activity, mammalian beta-defensins have been reported to have other roles in the immune system, such as the chemotactic ability for immature dendritic cells and memory T-cells via chemokine receptor-6 demonstrated by human beta-defensin-2. This entry contains beta-defensins such as DEFB136, the mouse homolog Defb42 and Ostricacin-3.


Pssm-ID: 375136  Cd Length: 51  Bit Score: 95.99  E-value: 2.75e-28
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 116325977  25 NDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP 75
Cdd:pfam17333  1 NDGVSVRTCTALGGLCFFGCKPGWKWVAFCHNILSCCKKDTKFKPPQAKEP 51
 
Name Accession Description Interval E-value
DEFB136 pfam17333
Beta defensin 136; Beta-defensins are small cationic peptides that have triple-stranded ...
25-75 2.75e-28

Beta defensin 136; Beta-defensins are small cationic peptides that have triple-stranded beta-sheet structure. They are characterized by the presence of multiple cysteine residues (forming three distinctive intramolecular disulfide bridges) and a highly similar tertiary structure known as the defensin motif. All beta-defensin genes encode a precursor peptide that consists of a hydrophobic, leucine-rich signal sequence, a pro-sequence, and a mature six-cysteine defensin motif at the carboxy terminus. They exhibit broad-spectrum antimicrobial properties and contribute to mucosal immune responses at epithelial sites. Several beta-defensins family members have been shown to play essential roles in sperm maturation and fertility in rats, mice and humans. In addition to the wide spectrum of antimicrobial activity, mammalian beta-defensins have been reported to have other roles in the immune system, such as the chemotactic ability for immature dendritic cells and memory T-cells via chemokine receptor-6 demonstrated by human beta-defensin-2. This entry contains beta-defensins such as DEFB136, the mouse homolog Defb42 and Ostricacin-3.


Pssm-ID: 375136  Cd Length: 51  Bit Score: 95.99  E-value: 2.75e-28
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
gi 116325977  25 NDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP 75
Cdd:pfam17333  1 NDGVSVRTCTALGGLCFFGCKPGWKWVAFCHNILSCCKKDTKFKPPQAKEP 51
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH