NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|7657027|ref|NP_056629|]
View 

dickkopf-related protein 3 isoform b precursor [Mus musculus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
Dkk3_N_Cys1 cd23014
N-terminus of Dickkopf-related protein 3; includes the first cysteine-rich (Cys-1) domain; ...
 41-196 8.92e-94

N-terminus of Dickkopf-related protein 3; includes the first cysteine-rich (Cys-1) domain; Dickkopf 3 (Dkk3) is a secreted protein which, in contrast to Dkk1, Dkk2, and Dkk4, does not interact with LRP5/6 (low-density lipoprotein receptor related protein 5 and 6), and thus is a divergent family member that is not considered a true Wnt signaling antagonist. The role of Dkk proteins in cancer is considered mainly tumor suppressive since they are usually down-regulated in cancer cells. Dkk3 links heat shock factor 1 (HSF1) and YAP/TAZ signaling to control aggressive behaviors in cancer-associated fibroblasts; it does so via canonical Wnt signaling. It belongs to the Dickkopf (Dkk) family that comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the N-terminal region of Dkk3, including the Cys-1 domain and a region to its N-terminus that shows similarity to Dickkopf-like protein 1 (Dkkl1).


:

Pssm-ID: 438008  Cd Length: 156  Bit Score: 276.29  E-value: 8.92e-94
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7657027   41 PQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKTSSEVNLASLPPNYHNETSTETRVGNNTVHVHQEVHKITN 120
Cdd:cd23014   1 PQEEATLNEMFREVEELMEDTQHKLRSAVHEMEAEEAAAKKSSEVNLANLPPNYHNESNTETKVGNNTIHTHQEIDKVTD 80

                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7657027  121 NQSGQVVFSETVITSVGDEEGKRSHECIIDEDCGPTRYCQFSSFKYTCQPCRDQQMLCTRDSECCGDQLCAWGHCT 196
Cdd:cd23014  81 NKTGSTVFSETVITSVGDEEGKRNHECIIDEDCGPGKYCQFSSFEYKCQPCKTQDMLCTRDSECCGDQLCVWGHCT 156
Dkk3_Cys2 cd23274
second cysteine-rich (Cys-2) domain of Dickkopf-related protein 3; Dickkopf 3 (Dkk3) is a ...
 199-285 1.10e-44

second cysteine-rich (Cys-2) domain of Dickkopf-related protein 3; Dickkopf 3 (Dkk3) is a secreted protein which, in contrast to Dkk1, Dkk2, and Dkk4, does not interact with LRP5/6 (low-density lipoprotein receptor related protein 5 and 6), and thus is a divergent family member that is not considered a true Wnt signaling antagonist. The role of Dkk proteins in cancer is considered mainly tumor suppressive since they are usually down-regulated in cancer cells. Dkk3 links heat shock factor 1 (HSF1) and YAP/TAZ signaling to control aggressive behaviors in cancer-associated fibroblasts; it does so via canonical Wnt signaling. It belongs to the Dickkopf (Dkk) family that comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the Cys-2 domain of Dkk3.


:

Pssm-ID: 438000  Cd Length: 86  Bit Score: 148.14  E-value: 1.10e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7657027  199 ATKGGNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPTSQLLDLITWELEPEGALDRCPCASGLLCQPhsH 278
Cdd:cd23274   2 ATKGEAGTICQYQSDCSPGLCCAFHKALLFPVCTPLPTEGEPCHDPSNHLLDLLSWDLEPEGPLEHCPCAGGLQCQP--H 79


                ....*..
gi 7657027  279 SLVYMCK 285
Cdd:cd23274  80 GRGSLCE 86
 
Name Accession Description Interval E-value
Dkk3_N_Cys1 cd23014
N-terminus of Dickkopf-related protein 3; includes the first cysteine-rich (Cys-1) domain; ...
 41-196 8.92e-94

N-terminus of Dickkopf-related protein 3; includes the first cysteine-rich (Cys-1) domain; Dickkopf 3 (Dkk3) is a secreted protein which, in contrast to Dkk1, Dkk2, and Dkk4, does not interact with LRP5/6 (low-density lipoprotein receptor related protein 5 and 6), and thus is a divergent family member that is not considered a true Wnt signaling antagonist. The role of Dkk proteins in cancer is considered mainly tumor suppressive since they are usually down-regulated in cancer cells. Dkk3 links heat shock factor 1 (HSF1) and YAP/TAZ signaling to control aggressive behaviors in cancer-associated fibroblasts; it does so via canonical Wnt signaling. It belongs to the Dickkopf (Dkk) family that comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the N-terminal region of Dkk3, including the Cys-1 domain and a region to its N-terminus that shows similarity to Dickkopf-like protein 1 (Dkkl1).


Pssm-ID: 438008  Cd Length: 156  Bit Score: 276.29  E-value: 8.92e-94
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7657027   41 PQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKTSSEVNLASLPPNYHNETSTETRVGNNTVHVHQEVHKITN 120
Cdd:cd23014   1 PQEEATLNEMFREVEELMEDTQHKLRSAVHEMEAEEAAAKKSSEVNLANLPPNYHNESNTETKVGNNTIHTHQEIDKVTD 80

                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7657027  121 NQSGQVVFSETVITSVGDEEGKRSHECIIDEDCGPTRYCQFSSFKYTCQPCRDQQMLCTRDSECCGDQLCAWGHCT 196
Cdd:cd23014  81 NKTGSTVFSETVITSVGDEEGKRNHECIIDEDCGPGKYCQFSSFEYKCQPCKTQDMLCTRDSECCGDQLCVWGHCT 156
Dkk3_Cys2 cd23274
second cysteine-rich (Cys-2) domain of Dickkopf-related protein 3; Dickkopf 3 (Dkk3) is a ...
 199-285 1.10e-44

second cysteine-rich (Cys-2) domain of Dickkopf-related protein 3; Dickkopf 3 (Dkk3) is a secreted protein which, in contrast to Dkk1, Dkk2, and Dkk4, does not interact with LRP5/6 (low-density lipoprotein receptor related protein 5 and 6), and thus is a divergent family member that is not considered a true Wnt signaling antagonist. The role of Dkk proteins in cancer is considered mainly tumor suppressive since they are usually down-regulated in cancer cells. Dkk3 links heat shock factor 1 (HSF1) and YAP/TAZ signaling to control aggressive behaviors in cancer-associated fibroblasts; it does so via canonical Wnt signaling. It belongs to the Dickkopf (Dkk) family that comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the Cys-2 domain of Dkk3.


Pssm-ID: 438000  Cd Length: 86  Bit Score: 148.14  E-value: 1.10e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7657027  199 ATKGGNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPTSQLLDLITWELEPEGALDRCPCASGLLCQPhsH 278
Cdd:cd23274   2 ATKGEAGTICQYQSDCSPGLCCAFHKALLFPVCTPLPTEGEPCHDPSNHLLDLLSWDLEPEGPLEHCPCAGGLQCQP--H 79


                ....*..
gi 7657027  279 SLVYMCK 285
Cdd:cd23274  80 GRGSLCE 86
Dickkopf_N pfam04706
Dickkopf N-terminal cysteine-rich region; Dickkopf proteins are a class of Wnt antagonists. ...
 146-196 7.72e-19

Dickkopf N-terminal cysteine-rich region; Dickkopf proteins are a class of Wnt antagonists. They possess two conserved cysteine-rich regions. This family represents the N-terminal one. The C-terminal region has been found to share significant sequence similarity to the colipase fold, pfam01114, pfam02740.


Pssm-ID: 461401  Cd Length: 51  Bit Score: 78.96  E-value: 7.72e-19
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 7657027    146 ECIIDEDCGPTRYCQFSSFKYTCQPCRDQQMLCTRDSECCGDQLCAWGHCT 196
Cdd:pfam04706   1 ECLSDEDCGKGKYCLSSSGESVCLPCRKRRKRCTRDAMCCPGNLCVNGVCV 51
 
Name Accession Description Interval E-value
Dkk3_N_Cys1 cd23014
N-terminus of Dickkopf-related protein 3; includes the first cysteine-rich (Cys-1) domain; ...
 41-196 8.92e-94

N-terminus of Dickkopf-related protein 3; includes the first cysteine-rich (Cys-1) domain; Dickkopf 3 (Dkk3) is a secreted protein which, in contrast to Dkk1, Dkk2, and Dkk4, does not interact with LRP5/6 (low-density lipoprotein receptor related protein 5 and 6), and thus is a divergent family member that is not considered a true Wnt signaling antagonist. The role of Dkk proteins in cancer is considered mainly tumor suppressive since they are usually down-regulated in cancer cells. Dkk3 links heat shock factor 1 (HSF1) and YAP/TAZ signaling to control aggressive behaviors in cancer-associated fibroblasts; it does so via canonical Wnt signaling. It belongs to the Dickkopf (Dkk) family that comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the N-terminal region of Dkk3, including the Cys-1 domain and a region to its N-terminus that shows similarity to Dickkopf-like protein 1 (Dkkl1).


Pssm-ID: 438008  Cd Length: 156  Bit Score: 276.29  E-value: 8.92e-94
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7657027   41 PQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKTSSEVNLASLPPNYHNETSTETRVGNNTVHVHQEVHKITN 120
Cdd:cd23014   1 PQEEATLNEMFREVEELMEDTQHKLRSAVHEMEAEEAAAKKSSEVNLANLPPNYHNESNTETKVGNNTIHTHQEIDKVTD 80

                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 7657027  121 NQSGQVVFSETVITSVGDEEGKRSHECIIDEDCGPTRYCQFSSFKYTCQPCRDQQMLCTRDSECCGDQLCAWGHCT 196
Cdd:cd23014  81 NKTGSTVFSETVITSVGDEEGKRNHECIIDEDCGPGKYCQFSSFEYKCQPCKTQDMLCTRDSECCGDQLCVWGHCT 156
Dkk3_Cys2 cd23274
second cysteine-rich (Cys-2) domain of Dickkopf-related protein 3; Dickkopf 3 (Dkk3) is a ...
 199-285 1.10e-44

second cysteine-rich (Cys-2) domain of Dickkopf-related protein 3; Dickkopf 3 (Dkk3) is a secreted protein which, in contrast to Dkk1, Dkk2, and Dkk4, does not interact with LRP5/6 (low-density lipoprotein receptor related protein 5 and 6), and thus is a divergent family member that is not considered a true Wnt signaling antagonist. The role of Dkk proteins in cancer is considered mainly tumor suppressive since they are usually down-regulated in cancer cells. Dkk3 links heat shock factor 1 (HSF1) and YAP/TAZ signaling to control aggressive behaviors in cancer-associated fibroblasts; it does so via canonical Wnt signaling. It belongs to the Dickkopf (Dkk) family that comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the Cys-2 domain of Dkk3.


Pssm-ID: 438000  Cd Length: 86  Bit Score: 148.14  E-value: 1.10e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7657027  199 ATKGGNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPTSQLLDLITWELEPEGALDRCPCASGLLCQPhsH 278
Cdd:cd23274   2 ATKGEAGTICQYQSDCSPGLCCAFHKALLFPVCTPLPTEGEPCHDPSNHLLDLLSWDLEPEGPLEHCPCAGGLQCQP--H 79


                ....*..
gi 7657027  279 SLVYMCK 285
Cdd:cd23274  80 GRGSLCE 86
Dkk_Cys2 cd23012
second cysteine-rich (Cys-2) domain of Dickkopf proteins; The Dickkopf (Dkk) family comprises ...
 201-285 2.46e-22

second cysteine-rich (Cys-2) domain of Dickkopf proteins; The Dickkopf (Dkk) family comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the Cys-2 domain of Dickkopf proteins 1- 4.


Pssm-ID: 437997  Cd Length: 77  Bit Score: 89.34  E-value: 2.46e-22
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7657027  201 KGGNGTICDNQRDCQPGLCCAFQrgLLFPVCTPLPVEGELCHDPTSQLLDLItwelepegALDRCPCASGLLCQPH--SH 278
Cdd:cd23012   1 KGREGESCLRSRDCAEGLCCARH--LWSKRCKPILLEGDVCTKPRRKKSRGL--------IFQRCDCGSGLSCRPQpdSH 70


                ....*..
gi 7657027  279 SLVYMCK 285
Cdd:cd23012  71 KRLHVCQ 77
Dickkopf_N pfam04706
Dickkopf N-terminal cysteine-rich region; Dickkopf proteins are a class of Wnt antagonists. ...
 146-196 7.72e-19

Dickkopf N-terminal cysteine-rich region; Dickkopf proteins are a class of Wnt antagonists. They possess two conserved cysteine-rich regions. This family represents the N-terminal one. The C-terminal region has been found to share significant sequence similarity to the colipase fold, pfam01114, pfam02740.


Pssm-ID: 461401  Cd Length: 51  Bit Score: 78.96  E-value: 7.72e-19
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 7657027    146 ECIIDEDCGPTRYCQFSSFKYTCQPCRDQQMLCTRDSECCGDQLCAWGHCT 196
Cdd:pfam04706   1 ECLSDEDCGKGKYCLSSSGESVCLPCRKRRKRCTRDAMCCPGNLCVNGVCV 51
Dkk_Cys1 cd23009
first cysteine-rich (Cys-1) domain of Dickkopf proteins; The Dickkopf (Dkk) family comprises a ...
 146-196 3.78e-17

first cysteine-rich (Cys-1) domain of Dickkopf proteins; The Dickkopf (Dkk) family comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the Cys-1 domain of Dickkopf proteins 1- 4.


Pssm-ID: 438006  Cd Length: 52  Bit Score: 74.46  E-value: 3.78e-17
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|..
gi 7657027  146 ECIIDEDCGPTRYCQF-SSFKYTCQPCRDQQMLCTRDSECCGDQLCAWGHCT 196
Cdd:cd23009   1 PCISDEDCGTSMYCQSpSDGQYTCQPCRGQRKRCTRDAMCCPGTLCVNGICT 52
Dkkl1 cd23006
Dickkopf-like protein 1; Dickkopf (Dkk) genes comprise an evolutionarily conserved small gene ...
 86-141 3.49e-12

Dickkopf-like protein 1; Dickkopf (Dkk) genes comprise an evolutionarily conserved small gene family of four members (Dkk1-4) and a unique Dkk3-related gene, Dkkl1, also called Dickkopf-like protein 1, cancer/testis antigen 34 (CT34), or sgy/soggy. Soggy is thought to play an important role in testicular development and spermatogenesis, and its abnormal expression may be an important factor in male infertility. It may promote spermatocyte apoptosis, thereby limiting sperm production. In adults, Dkkl1 may reduce testosterone synthesis in Leydig cells. Unlike the other members of the Dickkopf family, Soggy does not contain two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. It contains an N-terminal domain similar to that of the N-terminal region of Dkk3.


Pssm-ID: 438556  Cd Length: 166  Bit Score: 63.85  E-value: 3.49e-12
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 7657027   86 NLASLPPNYHNETSTETRVGNNTVHVHQEVHKITNNQSGQVVFSETVITSVGDEEG 141
Cdd:cd23006   1 DFRGLPRNYHKEENQEHRLGNSTLSSHLQIDKVTDNQTGEVLISEKVVAAIQPAEG 56
Dkk4_Cys2 cd23275
second cysteine-rich (Cys-2) domain of Dickkopf-related protein 4; Dickkopf 4 (Dkk4) is a ...
 201-275 3.88e-06

second cysteine-rich (Cys-2) domain of Dickkopf-related protein 4; Dickkopf 4 (Dkk4) is a secreted protein which directly binds to LRP5/6 (low-density lipoprotein receptor related protein 5 and 6), and is an inhibitor of Wnt/beta-catenin signaling. Dkk4, which is upregulated by the activated Wnt pathway, contributes to tumor malignancy in variable tumors, promoting tumor cell invasion and progression. Aberrant accumulation of Dkk4 has been shown to promote tumor progression by forming the immune suppressive microenvironment in gastrointestinal stromal tumor, and thus Dkk4 may be used as a tumor biomarker for prognosis prediction and recurrence monitoring. Dkk4 belongs to the Dickkopf (Dkk) family that comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the Cys-2 domain of Dkk4.


Pssm-ID: 438001  Cd Length: 94  Bit Score: 44.59  E-value: 3.88e-06
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 7657027  201 KGGNGTICDNQRDCQPGLCCAfqRGLLFPVCTPLPVEGELC----HDPTSQlldlitwelEPEgALDRCPCASGLLCQP 275
Cdd:cd23275  11 KGQEGESCLRTSDCGPGLCCA--RHFWTKICKPVLLEGQVCsrrgHKDTAQ---------GPE-IFQRCDCGPGLSCRS 77
Dkk1_Cys2 cd23272
second cysteine-rich (Cys-2) domain of Dickkopf-related protein 1; Dickkopf-1 (Dkk1) is a ...
 201-275 4.25e-05

second cysteine-rich (Cys-2) domain of Dickkopf-related protein 1; Dickkopf-1 (Dkk1) is a secreted protein which directly binds to LRP5/6 (low-density lipoprotein receptor related protein 5 and 6), and is an inhibitor of Wnt/beta-catenin signaling. Elevated expression of Dkk-1 may serve as a negative regulator for modulating the wnt/#-catenin signal pathway. Dkk1 is expressed in various human cancers. It has been studied extensively in mouse models of multiple myeloma that results in osteolytic bone lesions. Studies show that Dkk1 levels in bone marrow plasma and serum inhibit the differentiation of osteoblast precursors. Dkk1 belongs to the Dickkopf (Dkk) family that comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the Cys-2 domain of Dkk1.


Pssm-ID: 437998  Cd Length: 83  Bit Score: 41.60  E-value: 4.25e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 7657027  201 KGGNGTICDNQRDCQPGLCCAfqRGLLFPVCTPLPVEGELC---HDPTSQLLDLitwelepegaLDRCPCASGLLCQP 275
Cdd:cd23272   1 KGQEGDTCLRSSDCSEGLCCA--RHFWSKICKPVLKEGQVCtkhRRKGSHGLEI----------FQRCDCGDGLSCRT 66
Dkk2_Cys2 cd23273
second cysteine-rich (Cys-2) domain of Dickkopf-related protein 2; Dickkopf 2 (Dkk2) is a ...
 200-275 1.17e-03

second cysteine-rich (Cys-2) domain of Dickkopf-related protein 2; Dickkopf 2 (Dkk2) is a secreted protein which directly binds to LRP5/6 (low-density lipoprotein receptor related protein 5 and 6), and is an inhibitor of Wnt/beta-catenin signaling. Dkk2 expression is modulated by expression of micro RNA-221 (miRNA-221) in esophageal cancer, and inactivation of Dkk2 may increase Wnt activity with accelerating tumor progression. Dkk2 belongs to the Dickkopf (Dkk) family that comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the Cys-2 domain of Dkk2.


Pssm-ID: 437999  Cd Length: 84  Bit Score: 37.52  E-value: 1.17e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 7657027  200 TKGGNGTICDNQRDCQPGLCCAfqRGLLFPVCTPLPVEGELC---HDPTSQLLDLitwelepegaLDRCPCASGLLCQP 275
Cdd:cd23273   1 IKGHEGDPCLRSSDCAEGFCCA--RHFWTKICKPVLRQGEVCtkqRRKGSHGLEI----------FQRCDCAKGLSCKV 67
Dkk1_N_Cys1 cd23026
N-terminus of Dickkopf-related protein 1; includes the first cysteine-rich (Cys-1) domain; ...
 147-195 1.24e-03

N-terminus of Dickkopf-related protein 1; includes the first cysteine-rich (Cys-1) domain; Dickkopf-1 (Dkk1) is a secreted protein which directly binds to LRP5/6 (low-density lipoprotein receptor related protein 5 and 6), and is an inhibitor of Wnt/beta-catenin signaling. Elevated expression of Dkk-1 may serve as a negative regulator for modulating the wnt/#-catenin signal pathway. Dkk1 is expressed in various human cancers. It has been studied extensively in mouse models of multiple myeloma that results in osteolytic bone lesions. Studies show that Dkk1 levels in bone marrow plasma and serum inhibit the differentiation of osteoblast precursors. Dkk1 belongs to the Dickkopf (Dkk) family that comprises a discrete class of secreted Wnt inhibitors. The Wnt gene family is a large class of secreted proteins that are expressed in a variety of tissues and organs, and are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. Dkks 1-4 each possesses an N-terminal signal peptide and contains two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. Each domain possesses 10 conserved cysteine residues. The Cys-2 domain is closely similar to those in the colipase family; it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function. This model corresponds to the N-terminal region of Dkk1, including the Cys-1 domain.


Pssm-ID: 438010 [Multi-domain]  Cd Length: 122  Bit Score: 38.33  E-value: 1.24e-03
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|..
gi 7657027  147 CIIDEDCGPTRYCQFSSFKY---TCQPCRDQQMLCTRDSECCGDQLCAWGHC 195
Cdd:cd23026  70 CAEDEECGTDEYCASPTGVGgvqICLACRKRRKRCMRHAMCCPGNYCKNGIC 121
CLPS_Dkk_Cys2 cd23008
Colipase and the second cysteine-rich (Cys-2) domain of Dickkopf proteins; Colipase (also ...
 201-274 4.16e-03

Colipase and the second cysteine-rich (Cys-2) domain of Dickkopf proteins; Colipase (also called CLPS) is a cysteine-rich protein that adopts a similar fold to a cysteine-rich domain (Cys-2) of the Dickkopf (Dkk) family proteins. Colipase functions to prevent the inhibitory effect of bile salts on lipase-catalyzed intraduodenal hydrolysis of dietary long-chain triglycerides. Dickkopf proteins are a discrete class of secreted Wnt inhibitors that are required for many developmental processes, including segmentation, endoderm development, limb polarity, neural crest differentiation, kidney morphogenesis, sex determination and brain development. They possess an N-terminal signal peptide and contain two conserved cysteine-rich domains (Cys-1 and Cys-2) separated by a linker region. The Dickkopf Cys-2 domain is similar to proteins in the colipase family and it has been suggested that the Cys-2 domain of Dkks may enable interaction with lipids in order to regulate Wnt function.


Pssm-ID: 437995  Cd Length: 82  Bit Score: 35.74  E-value: 4.16e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 7657027  201 KGGNGTICDNQRDCQPGLCCafQRGLLFPVCTPLPVEGELCHDPTSQlldlitwELEPEGALDRCPCASGLLCQ 274
Cdd:cd23008   1 KGDEGELCLRSSDCKSGNCC--ARHFWLKICKPVLREGSVCTKFRLK-------GSHGLEIFQRCPCERGLSCE 65
CLPS cd23011
Colipase; Colipase, also called CLPS, is a protein co-enzyme required for optimal enzyme ...
 204-274 4.65e-03

Colipase; Colipase, also called CLPS, is a protein co-enzyme required for optimal enzyme activity of pancreatic lipase. It is secreted by the pancreas in an inactive form, procolipase, which is activated in the intestinal lumen by trypsin. Its function is to prevent the inhibitory effect of bile salts on the lipase-catalyzed intraduodenal hydrolysis of dietary long-chain triglycerides. Bile salts, at concentrations near their critical micellar concentration, desorb lipase from emulsified triacylglycerol and, thereby, inhibit lipolysis. Colipase functions by anchoring pancreatic lipase to the lipid-water interface through the formation of the stoichiometric colipase-lipase complex.


Pssm-ID: 437996  Cd Length: 84  Bit Score: 35.72  E-value: 4.65e-03
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 7657027  204 NGTICDNQRDCQPGlCCAFQRGLLFPVCTPLPVEGELCHDPTsqlldlitwelePEGALDRCPCASGLLCQ 274
Cdd:cd23011   8 NGELCLNSAQCKSG-CCHRDSGLSLARCAPKAAENQECSPKT------------LYGVYYKCPCESGLTCD 65
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH