NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1447699448|ref|NP_309648|]
View 

phage holin protein [Escherichia coli O157:H7 str. Sakai]

Protein Classification

phage holin family protein( domain architecture ID 11240852)

phage holin family protein may function in the transport of murein hydrolases (endolysins) across the cytoplasmic membrane to the cell wall where these enzymes hydrolyze the cell wall polymer as a prelude to cell lysis

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Phage_holin_3_3 pfam16083
LydA holin phage, holin superfamily III; Phage_holin_3_3 is a family of small hydrophobic ...
13-90 3.53e-17

LydA holin phage, holin superfamily III; Phage_holin_3_3 is a family of small hydrophobic holin proteins with one or more transmembrane domains. Holins are encoded within the genomes of Gram-positive and Gram-negative bacteria as well as those of the bacteriophages of these organizms. Their primary function appears to be transport of murein hydrolases across the cytoplasmic membrane to the cell wall where these enzymes hydrolyse the cell wall polymer as a prelude to cell lysis. When chromosomally encoded, these enzymes are therefore autolysins. Holins may also facilitate leakage of electrolytes and nutrients from the cell cytoplasm, thereby promoting cell death. Some may catalyze export of nucleases. LydA and lydB are encoded on the dar operon. The phenotype of a rapid lysis in the absence of active LydB suggests that this protein might be an antagonist of the holin LydA.


:

Pssm-ID: 435126  Cd Length: 78  Bit Score: 69.53  E-value: 3.53e-17
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1447699448  13 LVLLIIAGWGGLVRYLIDVKQSKATWSWINALAQIVVSGFTGVIGGLISIESGFSIYMILATAGISGAMGSVALTYFW 90
Cdd:pfam16083   1 LIIVAFAALGGIVRYLMRVKAGGRRFSIKELLGEIVVSGFVGLLVGLLCEESGLSQYLTAAIAGLFGYMGARGLIALW 78
 
Name Accession Description Interval E-value
Phage_holin_3_3 pfam16083
LydA holin phage, holin superfamily III; Phage_holin_3_3 is a family of small hydrophobic ...
13-90 3.53e-17

LydA holin phage, holin superfamily III; Phage_holin_3_3 is a family of small hydrophobic holin proteins with one or more transmembrane domains. Holins are encoded within the genomes of Gram-positive and Gram-negative bacteria as well as those of the bacteriophages of these organizms. Their primary function appears to be transport of murein hydrolases across the cytoplasmic membrane to the cell wall where these enzymes hydrolyse the cell wall polymer as a prelude to cell lysis. When chromosomally encoded, these enzymes are therefore autolysins. Holins may also facilitate leakage of electrolytes and nutrients from the cell cytoplasm, thereby promoting cell death. Some may catalyze export of nucleases. LydA and lydB are encoded on the dar operon. The phenotype of a rapid lysis in the absence of active LydB suggests that this protein might be an antagonist of the holin LydA.


Pssm-ID: 435126  Cd Length: 78  Bit Score: 69.53  E-value: 3.53e-17
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1447699448  13 LVLLIIAGWGGLVRYLIDVKQSKATWSWINALAQIVVSGFTGVIGGLISIESGFSIYMILATAGISGAMGSVALTYFW 90
Cdd:pfam16083   1 LIIVAFAALGGIVRYLMRVKAGGRRFSIKELLGEIVVSGFVGLLVGLLCEESGLSQYLTAAIAGLFGYMGARGLIALW 78
 
Name Accession Description Interval E-value
Phage_holin_3_3 pfam16083
LydA holin phage, holin superfamily III; Phage_holin_3_3 is a family of small hydrophobic ...
13-90 3.53e-17

LydA holin phage, holin superfamily III; Phage_holin_3_3 is a family of small hydrophobic holin proteins with one or more transmembrane domains. Holins are encoded within the genomes of Gram-positive and Gram-negative bacteria as well as those of the bacteriophages of these organizms. Their primary function appears to be transport of murein hydrolases across the cytoplasmic membrane to the cell wall where these enzymes hydrolyse the cell wall polymer as a prelude to cell lysis. When chromosomally encoded, these enzymes are therefore autolysins. Holins may also facilitate leakage of electrolytes and nutrients from the cell cytoplasm, thereby promoting cell death. Some may catalyze export of nucleases. LydA and lydB are encoded on the dar operon. The phenotype of a rapid lysis in the absence of active LydB suggests that this protein might be an antagonist of the holin LydA.


Pssm-ID: 435126  Cd Length: 78  Bit Score: 69.53  E-value: 3.53e-17
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 1447699448  13 LVLLIIAGWGGLVRYLIDVKQSKATWSWINALAQIVVSGFTGVIGGLISIESGFSIYMILATAGISGAMGSVALTYFW 90
Cdd:pfam16083   1 LIIVAFAALGGIVRYLMRVKAGGRRFSIKELLGEIVVSGFVGLLVGLLCEESGLSQYLTAAIAGLFGYMGARGLIALW 78
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH