NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|24583294|ref|NP_609363|]
View 

REPTOR-binding partner, isoform A [Drosophila melanogaster]

Protein Classification

bZIP transcription factor( domain architecture ID 10200381)

basic leucine zipper (bZIP) transcription factor binds to the promoter regions of genes to control their expression; similar to mammalian cAMP-responsive element-binding protein-like 2 and Drosophila melanogaster REPTOR-binding partner

CATH:  1.20.5.170
Gene Ontology:  GO:0006355|GO:0003700
PubMed:  23661758|7780801
SCOP:  4003836

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
bZIP_CREBL2 cd14709
Basic leucine zipper (bZIP) domain of Cyclic AMP-responsive element-binding protein-like 2 ...
42-97 6.93e-16

Basic leucine zipper (bZIP) domain of Cyclic AMP-responsive element-binding protein-like 2 (CREBL2): a DNA-binding and dimerization domain; CREBL2 is a bZIP transcription factor that interacts with CREB and plays a critical role in adipogenesis and lipogenesis. Its overexpression upregulates the expression of PPARgamma and CEBPalpha to promote adipogenesis as well as accelerate lipogenesis by increasing GLUT1 and GLUT4. bZIP factors act in networks of homo and heterodimers in the regulation of a diverse set of cellular processes. The bZIP structural motif contains a basic region and a leucine zipper, composed of alpha helices with leucine residues 7 amino acids apart, which stabilize dimerization with a parallel leucine zipper domain. Dimerization of leucine zippers creates a pair of the adjacent basic regions that bind DNA and undergo conformational change. Dimerization occurs in a specific and predictable manner resulting in hundreds of dimers having unique effects on transcription.


:

Pssm-ID: 269857 [Multi-domain]  Cd Length: 56  Bit Score: 66.20  E-value: 6.93e-16
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 24583294  42 DMKAKLERSRQSARECRARKKLRYQYLEELVADREKAVVALRTELERLIQWNNQLS 97
Cdd:cd14709   1 KKKAKLERNRQSARESRDRKKLRYQYLEQLVADREREILLLREELEMYKQWCEELD 56
 
Name Accession Description Interval E-value
bZIP_CREBL2 cd14709
Basic leucine zipper (bZIP) domain of Cyclic AMP-responsive element-binding protein-like 2 ...
42-97 6.93e-16

Basic leucine zipper (bZIP) domain of Cyclic AMP-responsive element-binding protein-like 2 (CREBL2): a DNA-binding and dimerization domain; CREBL2 is a bZIP transcription factor that interacts with CREB and plays a critical role in adipogenesis and lipogenesis. Its overexpression upregulates the expression of PPARgamma and CEBPalpha to promote adipogenesis as well as accelerate lipogenesis by increasing GLUT1 and GLUT4. bZIP factors act in networks of homo and heterodimers in the regulation of a diverse set of cellular processes. The bZIP structural motif contains a basic region and a leucine zipper, composed of alpha helices with leucine residues 7 amino acids apart, which stabilize dimerization with a parallel leucine zipper domain. Dimerization of leucine zippers creates a pair of the adjacent basic regions that bind DNA and undergo conformational change. Dimerization occurs in a specific and predictable manner resulting in hundreds of dimers having unique effects on transcription.


Pssm-ID: 269857 [Multi-domain]  Cd Length: 56  Bit Score: 66.20  E-value: 6.93e-16
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 24583294  42 DMKAKLERSRQSARECRARKKLRYQYLEELVADREKAVVALRTELERLIQWNNQLS 97
Cdd:cd14709   1 KKKAKLERNRQSARESRDRKKLRYQYLEQLVADREREILLLREELEMYKQWCEELD 56
 
Name Accession Description Interval E-value
bZIP_CREBL2 cd14709
Basic leucine zipper (bZIP) domain of Cyclic AMP-responsive element-binding protein-like 2 ...
42-97 6.93e-16

Basic leucine zipper (bZIP) domain of Cyclic AMP-responsive element-binding protein-like 2 (CREBL2): a DNA-binding and dimerization domain; CREBL2 is a bZIP transcription factor that interacts with CREB and plays a critical role in adipogenesis and lipogenesis. Its overexpression upregulates the expression of PPARgamma and CEBPalpha to promote adipogenesis as well as accelerate lipogenesis by increasing GLUT1 and GLUT4. bZIP factors act in networks of homo and heterodimers in the regulation of a diverse set of cellular processes. The bZIP structural motif contains a basic region and a leucine zipper, composed of alpha helices with leucine residues 7 amino acids apart, which stabilize dimerization with a parallel leucine zipper domain. Dimerization of leucine zippers creates a pair of the adjacent basic regions that bind DNA and undergo conformational change. Dimerization occurs in a specific and predictable manner resulting in hundreds of dimers having unique effects on transcription.


Pssm-ID: 269857 [Multi-domain]  Cd Length: 56  Bit Score: 66.20  E-value: 6.93e-16
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 24583294  42 DMKAKLERSRQSARECRARKKLRYQYLEELVADREKAVVALRTELERLIQWNNQLS 97
Cdd:cd14709   1 KKKAKLERNRQSARESRDRKKLRYQYLEQLVADREREILLLREELEMYKQWCEELD 56
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH