NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|24641425|ref|NP_727572|]
View 

uncharacterized protein Dmel_CG10347, isoform B [Drosophila melanogaster]

Protein Classification

NudC domain-containing protein( domain architecture ID 10158069)

NudC domain-containing protein similar to Aspergillus nidulans nuclear movement protein nudC that may interact between microtubules and nuclei and/or may be involved in the generation of force used to move nuclei during interphase

CATH:  2.60.40.790
PubMed:  21530541|26965524|12372593
SCOP:  4003073

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
p23_NUDC_like cd06467
p23_like domain of NUD (nuclear distribution) C and similar proteins. Aspergillus nidulas (An) ...
 296-377 9.64e-17

p23_like domain of NUD (nuclear distribution) C and similar proteins. Aspergillus nidulas (An) NUDC is needed for nuclear movement. AnNUDC is localized at the hyphal cortex, and binds NUDF at spindle pole bodies (SPBs) and in the cytoplasm at different stages in the cell cycle. At the SPBs it is part of the dynein molecular motor/NUDF complex that regulates microtubule dynamics. Mammalian(m) NUDC associates both with the dynein complex and also with an anti-inflammatory enzyme, platelet activating factor acetylhydrolase I, PAF-AH(I) complex, through binding mNUDF, the regulatory beta subunit of PAF-AH(I). mNUDC is important for cell proliferation both in normal and tumor tissues. Its expression is elevated in various cell types undergoing mitosis or stimulated to proliferate, with high expression levels observed in leukemic cells and tumors. For a leukemic cell line, human NUDC was shown to activate the thrombopoietin (TPO) receptor (Mpl) by binding to its extracellular domain, and promoting cell proliferation and differentiation. This group also includes the human broadly immunogenic tumor associated antigen, CML66, which is highly expressed in a variety of solid tumors and in leukemias. In normal tissues high expression of CML66 is limited to testis and heart.


:

Pssm-ID: 107224  Cd Length: 85  Bit Score: 75.28  E-value: 9.64e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24641425 296 YSWSQTDNNVLIRFNVPSTASAKEFNVSGSKT--TVVVKHlDEVIFDEELYASVGDDLSAFKLAENG-LELSLTKAEIQN 372
Cdd:cd06467   1 YSWTQTLDEVTVTIPLPEGTKSKDVKVEITPKhlKVGVKG-GEPLLDGELYAKVKVDESTWTLEDGKlLEITLEKRNEGE 79


                ....*.
gi 24641425 373 -WPRLF 377
Cdd:cd06467  80 wWPSLV 85
 
Name Accession Description Interval E-value
p23_NUDC_like cd06467
p23_like domain of NUD (nuclear distribution) C and similar proteins. Aspergillus nidulas (An) ...
 296-377 9.64e-17

p23_like domain of NUD (nuclear distribution) C and similar proteins. Aspergillus nidulas (An) NUDC is needed for nuclear movement. AnNUDC is localized at the hyphal cortex, and binds NUDF at spindle pole bodies (SPBs) and in the cytoplasm at different stages in the cell cycle. At the SPBs it is part of the dynein molecular motor/NUDF complex that regulates microtubule dynamics. Mammalian(m) NUDC associates both with the dynein complex and also with an anti-inflammatory enzyme, platelet activating factor acetylhydrolase I, PAF-AH(I) complex, through binding mNUDF, the regulatory beta subunit of PAF-AH(I). mNUDC is important for cell proliferation both in normal and tumor tissues. Its expression is elevated in various cell types undergoing mitosis or stimulated to proliferate, with high expression levels observed in leukemic cells and tumors. For a leukemic cell line, human NUDC was shown to activate the thrombopoietin (TPO) receptor (Mpl) by binding to its extracellular domain, and promoting cell proliferation and differentiation. This group also includes the human broadly immunogenic tumor associated antigen, CML66, which is highly expressed in a variety of solid tumors and in leukemias. In normal tissues high expression of CML66 is limited to testis and heart.


Pssm-ID: 107224  Cd Length: 85  Bit Score: 75.28  E-value: 9.64e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24641425 296 YSWSQTDNNVLIRFNVPSTASAKEFNVSGSKT--TVVVKHlDEVIFDEELYASVGDDLSAFKLAENG-LELSLTKAEIQN 372
Cdd:cd06467   1 YSWTQTLDEVTVTIPLPEGTKSKDVKVEITPKhlKVGVKG-GEPLLDGELYAKVKVDESTWTLEDGKlLEITLEKRNEGE 79


                ....*.
gi 24641425 373 -WPRLF 377
Cdd:cd06467  80 wWPSLV 85
CS pfam04969
CS domain; The CS and CHORD (pfam04968) are fused into a single polypeptide chain in metazoans ...
 294-367 1.92e-11

CS domain; The CS and CHORD (pfam04968) are fused into a single polypeptide chain in metazoans but are found in separate proteins in plants; this is thought to be indicative of an interaction between CS and CHORD. It has been suggested that the CS domain is a binding module for HSP90, implying that CS domain-containing proteins are involved in recruiting heat shock proteins to multiprotein assemblies. Two CS domains are found at the N-terminus of Ubiquitin carboxyl-terminal hydrolase 19 (USP19), these domains may play a role in the interaction of USP19 with cellular inhibitor of apoptosis 2.


Pssm-ID: 461503  Cd Length: 76  Bit Score: 59.96  E-value: 1.92e-11
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 24641425   294 PSYSWSQTDNNVLIRFNVP-STASAKEFNVSGSKTTVVVKHLDE-VIFDEELYASVGDDLSAFKLAENGLELSLTK 367
Cdd:pfam04969   1 PRYDWYQTLDEVTITIPVKgAGIKKKDVKVNIKPRSLKVKIKGGyELIDGELFHPIDPEESSWTIEGKKVEITLKK 76
 
Name Accession Description Interval E-value
p23_NUDC_like cd06467
p23_like domain of NUD (nuclear distribution) C and similar proteins. Aspergillus nidulas (An) ...
 296-377 9.64e-17

p23_like domain of NUD (nuclear distribution) C and similar proteins. Aspergillus nidulas (An) NUDC is needed for nuclear movement. AnNUDC is localized at the hyphal cortex, and binds NUDF at spindle pole bodies (SPBs) and in the cytoplasm at different stages in the cell cycle. At the SPBs it is part of the dynein molecular motor/NUDF complex that regulates microtubule dynamics. Mammalian(m) NUDC associates both with the dynein complex and also with an anti-inflammatory enzyme, platelet activating factor acetylhydrolase I, PAF-AH(I) complex, through binding mNUDF, the regulatory beta subunit of PAF-AH(I). mNUDC is important for cell proliferation both in normal and tumor tissues. Its expression is elevated in various cell types undergoing mitosis or stimulated to proliferate, with high expression levels observed in leukemic cells and tumors. For a leukemic cell line, human NUDC was shown to activate the thrombopoietin (TPO) receptor (Mpl) by binding to its extracellular domain, and promoting cell proliferation and differentiation. This group also includes the human broadly immunogenic tumor associated antigen, CML66, which is highly expressed in a variety of solid tumors and in leukemias. In normal tissues high expression of CML66 is limited to testis and heart.


Pssm-ID: 107224  Cd Length: 85  Bit Score: 75.28  E-value: 9.64e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24641425 296 YSWSQTDNNVLIRFNVPSTASAKEFNVSGSKT--TVVVKHlDEVIFDEELYASVGDDLSAFKLAENG-LELSLTKAEIQN 372
Cdd:cd06467   1 YSWTQTLDEVTVTIPLPEGTKSKDVKVEITPKhlKVGVKG-GEPLLDGELYAKVKVDESTWTLEDGKlLEITLEKRNEGE 79


                ....*.
gi 24641425 373 -WPRLF 377
Cdd:cd06467  80 wWPSLV 85
CS pfam04969
CS domain; The CS and CHORD (pfam04968) are fused into a single polypeptide chain in metazoans ...
 294-367 1.92e-11

CS domain; The CS and CHORD (pfam04968) are fused into a single polypeptide chain in metazoans but are found in separate proteins in plants; this is thought to be indicative of an interaction between CS and CHORD. It has been suggested that the CS domain is a binding module for HSP90, implying that CS domain-containing proteins are involved in recruiting heat shock proteins to multiprotein assemblies. Two CS domains are found at the N-terminus of Ubiquitin carboxyl-terminal hydrolase 19 (USP19), these domains may play a role in the interaction of USP19 with cellular inhibitor of apoptosis 2.


Pssm-ID: 461503  Cd Length: 76  Bit Score: 59.96  E-value: 1.92e-11
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 24641425   294 PSYSWSQTDNNVLIRFNVP-STASAKEFNVSGSKTTVVVKHLDE-VIFDEELYASVGDDLSAFKLAENGLELSLTK 367
Cdd:pfam04969   1 PRYDWYQTLDEVTITIPVKgAGIKKKDVKVNIKPRSLKVKIKGGyELIDGELFHPIDPEESSWTIEGKKVEITLKK 76
p23_like cd06463
Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) ...
 298-377 5.88e-11

Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1. Both are co-chaperones for the heat shock protein (Hsp) 90. p23 binds Hsp90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor. p23 also has a passive chaperoning activity and in addition may participate in prostaglandin synthesis. Both p23 and Sba1p can regulate telomerase activity. This group includes domains similar to the C-terminal CHORD-SGT1 (CS) domain of suppressor of G2 allele of Skp1 (Sgt1). Sgt1 interacts with multiple protein complexes and has the features of a co-chaperone. Human (h) Sgt1 interacts with both Hsp70 and Hsp90, and has been shown to bind Hsp90 through its CS domain. Saccharomyces cerevisiae (Sc) Sgt1 is a subunit of both core kinetochore and SCF (Skp1-Cul1-F-box) ubiquitin ligase complexes. Sgt1 is required for pathogen resistance in plants. This group also includes the p23_like domains of human butyrate-induced transcript 1 (hB-ind1), NUD (nuclear distribution) C, Melusin, and NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR). hB-ind1 plays a role in the signaling pathway mediated by the small GTPase Rac1, NUDC is needed for nuclear movement, Melusin interacts with two splice variants of beta1 integrin, and NCB5OR plays a part in maintaining viable pancreatic beta cells.


Pssm-ID: 107220  Cd Length: 84  Bit Score: 58.84  E-value: 5.88e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24641425 298 WSQTDNNVLIRFNVPStASAKEFNVSGSKTTVVVKHLD----EVIFDEELYASVGDDLSAFKLAENGLELSLTKAE-IQN 372
Cdd:cd06463   1 WYQTLDEVTITIPLKD-VTKKDVKVEFTPKSLTVSVKGgggkEYLLEGELFGPIDPEESKWTVEDRKIEITLKKKEpGEW 79


                ....*
gi 24641425 373 WPRLF 377
Cdd:cd06463  80 WPRLE 84
p23_CS_SGT1_like cd06466
p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 ...
 298-376 1.04e-04

p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1). Sgt1 interacts with multiple protein complexes and has the features of a cochaperone. Human (h) Sgt1 interacts with both Hsp70 and Hsp90, and has been shown to bind Hsp90 through its CS domain. Saccharomyces cerevisiae (Sc) Sgt1 is a subunit of both core kinetochore and SCF (Skp1-Cul1-F-box) ubiquitin ligase complexes. Sgt1 is required for pathogen resistance in plants. ScSgt1 is needed for the G1/S and G2/M cell-cycle transitions, and for assembly of the core kinetochore complex (CBF3) via activation of Ctf13, the F-box protein. Binding of Hsp82 (a yeast Hsp90 homologue) to ScSgt1, promotes the binding of Sgt1 to Skp1 and of Skp1 to Ctf13. Some proteins in this group have an SGT1-specific (SGS) domain at the extreme C-terminus. The ScSgt1-SGS domain binds adenylate cyclase. The hSgt1-SGS domain interacts with some S100 family proteins, and studies suggest that the interaction of hSgt1 with Hsp90 and Hsp70 may be regulated by S100A6 in a Ca2+ dependent fashion. This group also includes the p23_like domains of Melusin and NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR). Melusin is a vertebrate protein which interacts with two splice variants of beta1 integrin, and NCB5OR plays a part in maintaining viable pancreatic beta cells.


Pssm-ID: 107223  Cd Length: 84  Bit Score: 41.03  E-value: 1.04e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24641425 298 WSQTDNNVLIRF---NVPSTASAKEFNvsGSKTTVVVKHLDEVIF--DEELYASVGDDLSAFKLAENGLELSLTKAEIQN 372
Cdd:cd06466   2 WYQTDTSVTVTIyakNVDKEDVKVEFN--EQSLSVSIILPGGSEYqlELDLFGPIDPEQSKVSVLPTKVEITLKKAEPGS 79


                ....
gi 24641425 373 WPRL 376
Cdd:cd06466  80 WPSL 83
p23_NUDCD1_like cd06493
p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear ...
 296-376 2.15e-03

p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins. NUDCD1/CML66 is a broadly immunogenic tumor associated antigen, which is highly expressed in a variety of solid tumors and in leukemias. In normal tissues high expression of NUDCD1/CML66 is limited to testis and heart.


Pssm-ID: 107242  Cd Length: 85  Bit Score: 37.50  E-value: 2.15e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24641425 296 YSWSQTDNNVLIRFNVPSTASAKEFNV--SGSKTTVVVKHlDEVIFDEELYASVGDDLSAFKLAEN-GLELSLTK-AEIQ 371
Cdd:cd06493   1 YYWQQTEEDLTLTIRLPEDTTKEDIRIkfLPDHISIALKD-QAPLLEGKLYSSIDHESSTWIIKENkSLEVSLIKkDEGP 79


                ....*
gi 24641425 372 NWPRL 376
Cdd:cd06493  80 TWPEL 84
p23_hB-ind1_like cd06465
p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins. ...
 294-376 9.64e-03

p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins. hB-ind1 participates in signaling by the small GTPase Rac1. It binds to Rac1 and enhances different Rac1 effects including activation of nuclear factor (NF) kappaB and activation of c-Jun N-terminal kinase (JNK). hB-ind1 also plays a part in the RNA replication and particle production of Hepatitis C virus (HCV) through its interaction with heat shock protein Hsp90, HCV nonstructural protein 5A (NS5A), and the immunophilin FKBP8. hB-ind1 is upregulated in the outer layer of Chinese hamster V79 cells grown as multicell spheroids, versus in the same cells grown as monolayers. This group includes the Saccharomyces cerevisiae Sba1, a co-chaperone of the Hsp90. Sba1 has been shown to be is required for telomere length maintenance, and may modulate telomerase DNA-binding activity.


Pssm-ID: 107222 [Multi-domain]  Cd Length: 108  Bit Score: 36.03  E-value: 9.64e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24641425 294 PSYSWSQTDNNVLIRFNVPStasAKEFNVSGSKTTVVVK---HLDEVI--FDEELYASVGDDLSAFKLAENGLELSLTKA 368
Cdd:cd06465   1 PPVLWAQRSDVVYLTIELPD---AKDPKIKLEPTSLSFKakgGGGGKKyeFDLEFYKEIDPEESKYKVTGRQIEFVLRKK 77


                ....*....
gi 24641425 369 EI-QNWPRL 376
Cdd:cd06465  78 EAgEYWPRL 86
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH