NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1958771157|ref|XP_038964160|]
View 

sarcospan isoform X2 [Rattus norvegicus]

Protein Classification

CD20-like domain-containing protein( domain architecture ID 10513721)

CD20-like domain-containing protein similar to Homo sapiens B-lymphocyte antigen CD20 that may be involved in the regulation of B-cell activation and proliferation

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CD20 pfam04103
CD20-like family; This family includes the CD20 protein and the beta subunit of the high ...
9-107 1.43e-09

CD20-like family; This family includes the CD20 protein and the beta subunit of the high affinity receptor for IgE Fc. The high affinity receptor for IgE is a tetrameric structure consisting of a single IgE-binding alpha subunit, a single beta subunit, and two disulfide-linked gamma subunits. The alpha subunit of Fc epsilon RI and most Fc receptors are homologous members of the Ig superfamily. By contrast, the beta and gamma subunits from Fc epsilon RI are not homologous to the Ig superfamily. Both molecules have four putative transmembrane segments and a probably topology where both amino- and carboxy termini protrude into the cytoplasm. This family also includes LR8 like proteins from humans, mice and rats. The function of the human LR8 protein is unknown although it is known to be strongly expressed in the lung fibroblasts. This family also includes sarcospan is a transmembrane component of dystrophin-associated glycoprotein. Loss of the sarcoglycan complex and sarcospan alone is sufficient to cause muscular dystrophy. The role of the sarcoglycan complex and sarcospan is thought to be to strengthen the dystrophin axis connecting the basement membrane with the cytoskeleton.


:

Pssm-ID: 461174  Cd Length: 155  Bit Score: 53.03  E-value: 1.43e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958771157   9 DERTCVQFSMKVFYFLLSALGLMVCTLAVAFAAHHYSLLAQF-TCETSLDSCQCRLPSAEPLSRAFVYRDVTDCSSITGT 87
Cdd:pfam04103  56 KLLVLLSLLLNLLSLFTAVAGIILLSLSLALLTSAHECCMSEsDLTPSTSTCSCKSSSEDPECRAYCSSLRGLFTGILSM 135
                          90       100
                  ....*....|....*....|
gi 1958771157  88 FKLFLVIQMVLNLVCGLVCL 107
Cdd:pfam04103 136 LLILTVLELLVSLLSAILGC 155
 
Name Accession Description Interval E-value
CD20 pfam04103
CD20-like family; This family includes the CD20 protein and the beta subunit of the high ...
9-107 1.43e-09

CD20-like family; This family includes the CD20 protein and the beta subunit of the high affinity receptor for IgE Fc. The high affinity receptor for IgE is a tetrameric structure consisting of a single IgE-binding alpha subunit, a single beta subunit, and two disulfide-linked gamma subunits. The alpha subunit of Fc epsilon RI and most Fc receptors are homologous members of the Ig superfamily. By contrast, the beta and gamma subunits from Fc epsilon RI are not homologous to the Ig superfamily. Both molecules have four putative transmembrane segments and a probably topology where both amino- and carboxy termini protrude into the cytoplasm. This family also includes LR8 like proteins from humans, mice and rats. The function of the human LR8 protein is unknown although it is known to be strongly expressed in the lung fibroblasts. This family also includes sarcospan is a transmembrane component of dystrophin-associated glycoprotein. Loss of the sarcoglycan complex and sarcospan alone is sufficient to cause muscular dystrophy. The role of the sarcoglycan complex and sarcospan is thought to be to strengthen the dystrophin axis connecting the basement membrane with the cytoskeleton.


Pssm-ID: 461174  Cd Length: 155  Bit Score: 53.03  E-value: 1.43e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958771157   9 DERTCVQFSMKVFYFLLSALGLMVCTLAVAFAAHHYSLLAQF-TCETSLDSCQCRLPSAEPLSRAFVYRDVTDCSSITGT 87
Cdd:pfam04103  56 KLLVLLSLLLNLLSLFTAVAGIILLSLSLALLTSAHECCMSEsDLTPSTSTCSCKSSSEDPECRAYCSSLRGLFTGILSM 135
                          90       100
                  ....*....|....*....|
gi 1958771157  88 FKLFLVIQMVLNLVCGLVCL 107
Cdd:pfam04103 136 LLILTVLELLVSLLSAILGC 155
 
Name Accession Description Interval E-value
CD20 pfam04103
CD20-like family; This family includes the CD20 protein and the beta subunit of the high ...
9-107 1.43e-09

CD20-like family; This family includes the CD20 protein and the beta subunit of the high affinity receptor for IgE Fc. The high affinity receptor for IgE is a tetrameric structure consisting of a single IgE-binding alpha subunit, a single beta subunit, and two disulfide-linked gamma subunits. The alpha subunit of Fc epsilon RI and most Fc receptors are homologous members of the Ig superfamily. By contrast, the beta and gamma subunits from Fc epsilon RI are not homologous to the Ig superfamily. Both molecules have four putative transmembrane segments and a probably topology where both amino- and carboxy termini protrude into the cytoplasm. This family also includes LR8 like proteins from humans, mice and rats. The function of the human LR8 protein is unknown although it is known to be strongly expressed in the lung fibroblasts. This family also includes sarcospan is a transmembrane component of dystrophin-associated glycoprotein. Loss of the sarcoglycan complex and sarcospan alone is sufficient to cause muscular dystrophy. The role of the sarcoglycan complex and sarcospan is thought to be to strengthen the dystrophin axis connecting the basement membrane with the cytoskeleton.


Pssm-ID: 461174  Cd Length: 155  Bit Score: 53.03  E-value: 1.43e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1958771157   9 DERTCVQFSMKVFYFLLSALGLMVCTLAVAFAAHHYSLLAQF-TCETSLDSCQCRLPSAEPLSRAFVYRDVTDCSSITGT 87
Cdd:pfam04103  56 KLLVLLSLLLNLLSLFTAVAGIILLSLSLALLTSAHECCMSEsDLTPSTSTCSCKSSSEDPECRAYCSSLRGLFTGILSM 135
                          90       100
                  ....*....|....*....|
gi 1958771157  88 FKLFLVIQMVLNLVCGLVCL 107
Cdd:pfam04103 136 LLILTVLELLVSLLSAILGC 155
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH