NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2024453049|ref|XP_040537195|]
View 

G patch domain-containing protein 1 [Gallus gallus]

Protein Classification

G patch domain-containing protein 1( domain architecture ID 10543151)

G patch domain-containing protein 1 (GPTC1)

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DUF1604 pfam07713
Protein of unknown function (DUF1604); This family is found at the N-terminus of several ...
32-117 7.17e-44

Protein of unknown function (DUF1604); This family is found at the N-terminus of several eukaryotic RNA processing proteins.


:

Pssm-ID: 462241  Cd Length: 84  Bit Score: 153.06  E-value: 7.17e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2024453049  32 PVPLQEQTVKDAKGRyQRFHGAFTGGFSAGYFNTVGTKEGWTPSAFISSRQKRADRTVLGPEDFMDEEDLSEFGiAPRDI 111
Cdd:pfam07713   1 YVPVWKQEVRDEQGR-RRFHGAFTGGFSAGYFNTVGSKEGWTPSTFKSSRSNRAKKKQQRPEDFMDEEDLGEFG-APRQL 78

                  ....*.
gi 2024453049 112 TTTDDF 117
Cdd:pfam07713  79 RTTDEF 84
G-patch pfam01585
G-patch domain; This domain is found in a number of RNA binding proteins, and is also found in ...
156-182 8.92e-05

G-patch domain; This domain is found in a number of RNA binding proteins, and is also found in proteins that contain RNA binding domains. This suggests that this domain may have an RNA binding function. This domain has seven highly conserved glycines.


:

Pssm-ID: 396249 [Multi-domain]  Cd Length: 45  Bit Score: 40.57  E-value: 8.92e-05
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 2024453049 156 IGVELLRKMGWKEGQGIGP---------RVKRKPRR 182
Cdd:pfam01585   4 IGFKLLQKMGWKEGQGLGKneqgiaepiEAKIKKDR 39
 
Name Accession Description Interval E-value
DUF1604 pfam07713
Protein of unknown function (DUF1604); This family is found at the N-terminus of several ...
32-117 7.17e-44

Protein of unknown function (DUF1604); This family is found at the N-terminus of several eukaryotic RNA processing proteins.


Pssm-ID: 462241  Cd Length: 84  Bit Score: 153.06  E-value: 7.17e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2024453049  32 PVPLQEQTVKDAKGRyQRFHGAFTGGFSAGYFNTVGTKEGWTPSAFISSRQKRADRTVLGPEDFMDEEDLSEFGiAPRDI 111
Cdd:pfam07713   1 YVPVWKQEVRDEQGR-RRFHGAFTGGFSAGYFNTVGSKEGWTPSTFKSSRSNRAKKKQQRPEDFMDEEDLGEFG-APRQL 78

                  ....*.
gi 2024453049 112 TTTDDF 117
Cdd:pfam07713  79 RTTDEF 84
G-patch pfam01585
G-patch domain; This domain is found in a number of RNA binding proteins, and is also found in ...
156-182 8.92e-05

G-patch domain; This domain is found in a number of RNA binding proteins, and is also found in proteins that contain RNA binding domains. This suggests that this domain may have an RNA binding function. This domain has seven highly conserved glycines.


Pssm-ID: 396249 [Multi-domain]  Cd Length: 45  Bit Score: 40.57  E-value: 8.92e-05
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 2024453049 156 IGVELLRKMGWKEGQGIGP---------RVKRKPRR 182
Cdd:pfam01585   4 IGFKLLQKMGWKEGQGLGKneqgiaepiEAKIKKDR 39
G_patch smart00443
glycine rich nucleic binding domain; A predicted glycine rich nucleic binding domain found in ...
156-173 4.28e-04

glycine rich nucleic binding domain; A predicted glycine rich nucleic binding domain found in the splicing factor 45, SON DNA binding protein and D-type Retrovirus- polyproteins.


Pssm-ID: 197727 [Multi-domain]  Cd Length: 47  Bit Score: 38.68  E-value: 4.28e-04
                           10
                   ....*....|....*...
gi 2024453049  156 IGVELLRKMGWKEGQGIG 173
Cdd:smart00443   6 IGAKLLRKMGWKEGQGLG 23
 
Name Accession Description Interval E-value
DUF1604 pfam07713
Protein of unknown function (DUF1604); This family is found at the N-terminus of several ...
32-117 7.17e-44

Protein of unknown function (DUF1604); This family is found at the N-terminus of several eukaryotic RNA processing proteins.


Pssm-ID: 462241  Cd Length: 84  Bit Score: 153.06  E-value: 7.17e-44
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2024453049  32 PVPLQEQTVKDAKGRyQRFHGAFTGGFSAGYFNTVGTKEGWTPSAFISSRQKRADRTVLGPEDFMDEEDLSEFGiAPRDI 111
Cdd:pfam07713   1 YVPVWKQEVRDEQGR-RRFHGAFTGGFSAGYFNTVGSKEGWTPSTFKSSRSNRAKKKQQRPEDFMDEEDLGEFG-APRQL 78

                  ....*.
gi 2024453049 112 TTTDDF 117
Cdd:pfam07713  79 RTTDEF 84
G-patch pfam01585
G-patch domain; This domain is found in a number of RNA binding proteins, and is also found in ...
156-182 8.92e-05

G-patch domain; This domain is found in a number of RNA binding proteins, and is also found in proteins that contain RNA binding domains. This suggests that this domain may have an RNA binding function. This domain has seven highly conserved glycines.


Pssm-ID: 396249 [Multi-domain]  Cd Length: 45  Bit Score: 40.57  E-value: 8.92e-05
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 2024453049 156 IGVELLRKMGWKEGQGIGP---------RVKRKPRR 182
Cdd:pfam01585   4 IGFKLLQKMGWKEGQGLGKneqgiaepiEAKIKKDR 39
G_patch smart00443
glycine rich nucleic binding domain; A predicted glycine rich nucleic binding domain found in ...
156-173 4.28e-04

glycine rich nucleic binding domain; A predicted glycine rich nucleic binding domain found in the splicing factor 45, SON DNA binding protein and D-type Retrovirus- polyproteins.


Pssm-ID: 197727 [Multi-domain]  Cd Length: 47  Bit Score: 38.68  E-value: 4.28e-04
                           10
                   ....*....|....*...
gi 2024453049  156 IGVELLRKMGWKEGQGIG 173
Cdd:smart00443   6 IGAKLLRKMGWKEGQGLG 23
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH