Conserved Protein Domain Family
srtB_sig_QVPTGV
?
TIGR03065: srtB_sig_QVPTGV 
sortase B signal domain, QVPTGV class
This model represents a boutique (unusual) sorting signal, recognized by a member of the sortase SrtB family rather than by the housekeeping sortase, SrtA.
Links
?
Statistics
?
PSSM-Id: 132109
Aligned: 2 rows
Threshold Bit Score: 56.0569
Created: 8-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
WP_023077311 191 QVPTGVVGTLAPFAVLSIVAIGGVIYITKRKK 222 Streptococcus pyogenes
WP_021280971  98 EVPTGVAMTVAPYIALGIVAVGGALYFVKKKN 129 Streptococcus pyogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap