Conserved Protein Domain Family
BA14K
?
pfam07886: BA14K 
BA14K-like protein
The sequences found in this family are similar to the BA14K proteins expressed by Brucella abortus and by Brucella suis. BA14K was found to be strongly immunoreactive; it induces both humoral and cellular responses in hosts throughout the infective process.
Links
?
Statistics
?
PSSM-Id: 429716
Aligned: 44 rows
Threshold Bit Score: 40.5458
Created: 22-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
Q11H54       199 HIRACFARYRSYRPEDNTYQPYGgGPRRQCD 229 Chelativorans sp. BNC1
WP_012319432 201 ddRACARRFRSYDPQSGTYLGRD-GRRHRCR 230 Methylobacterium radiotolerans
BAF90443     189 WQAYCASKYRSFDPRTGTYLGYD-GLRHPCQ 218
WP_012385337 108 WIAYCARKYRSFDPASGTYLAYD-GNRYMCQ 137 Beijerinckia indica
WP_011927689 105 sQVYCAQRYRSYDPRSGTYLGND-GRRHSCP 134 Bradyrhizobium sp. ORS 278
Q1QQC5        97 NAAYCSRRYRSYDPASGTYLNND-GYRYPCP 126 Nitrobacter hamburgensis X14
Q213J9       167 SVAYCKRRYRSYDPASGTYLGYD-GLRHPCP 196 Rhodopseudomonas palustris BisB18
Q1QLL8       143 DVAYCQQRFKSYDVSSGTYLGYD-GKRHPCP 172 Nitrobacter hamburgensis X14
WP_009736533 113 AVAYCMQRYRSYDPASGTYLNYD-GNRYPCP 142 Bradyrhizobiaceae bacterium SG-6C
WP_012335081 100 AVAACARRFRSYDPASGTYLGHD-GVRHPCP 129 Methylobacterium sp. 4-46
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap