Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AB065494.1
FASTA Graphics
LOCUS AB065494 1360 bp DNA linear PRI 23-JUL-2002 DEFINITION Homo sapiens gene for seven transmembrane helix receptor, complete cds, isolate:CBRC7TM_57. ACCESSION AB065494 VERSION AB065494.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 AUTHORS Suwa,M., Sato,T., Okouchi,I., Arita,M., Futami,K., Matsumoto,S., Tsutsumi,S., Aburatani,H., Asai,K. and Akiyama,Y. TITLE Genome-wide discovery and analysis of human seven transmembrane helix receptor genes JOURNAL Unpublished REFERENCE 2 (bases 1 to 1360) AUTHORS Suwa,M. TITLE Direct Submission JOURNAL Submitted (11-JUL-2001) Makiko Suwa, Computational Biology Research Center (CBRC), National Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp, URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081) COMMENT This sequence is a seven transmembrane helix receptor candidate predicted from the whole human genome sequences using our automated system that contains programs of gene finding(GeneDecoder), sequence search, motif-domain assignment and transmembrane helix prediction. And the sequence is submitted by the collaborative project between [Computational Biology Research Center (CBRC), National Institute of Advanced Industrial Science and Technology (AIST)] and [Genome Science Division, Research Center for Advanced Science and Technology (RCAST), University of Tokyo]. FEATURES Location/Qualifiers source 1..1360 /organism="Homo sapiens" /mol_type="genomic DNA" /isolate="CBRC7TM_57" /db_xref="taxon:9606" /chromosome="11" CDS 201..1160 /inference="non-experimental evidence, no additional details recorded" /codon_start=1 /product="seven transmembrane helix receptor" /protein_id="BAC05746.1" /translation="MTPGELALASGNHTPVTKFILQGFSNYPDLQELLFGAILLIYAI TVVGNLGMMALIFTDSHLQSPMYFFLNVLSFLDICYSSVVTPKLLVNFLVSDKSISFE GCVVQLAFFVVHVTAESFLLASMAYDRFLAICQPLHYGSIMTRGTCLQLVAVSYAFGG ANSAIQTGNVFALPFCGPNQLTHYYCDIPPLLHLACANTATARVVLYVFSALVTLLPA AVILTSYCLVLVAIGRMRSVAGREKDLSTCASHFLAIAIFYGTVVFTYVQPHGSTNNT NGQVVSVFYTIIIPMLNPFIYSLRNKEVKGALQRKLQVNIFPG" ORIGIN 1 aacagatgct gatgccatgc ttgcacagcc tgcagaacca ggagccaaat aaatctcttt 61 tctttataaa tttacccagt ttcagatatt ccttaatagc aacacaaaac agattgaaat 121 tcttcctcat tgtaccttgc acagatgtag acgtgctcaa gtaatactgt ttgagtgatt 181 gccaactgta acctctgcag atgacacctg gagaactagc ccttgccagt ggcaaccaca 241 ccccagtcac caagttcatc ttgcagggat tctccaatta tccagacctc caggagcttc 301 tcttcggagc catcctgctc atctatgcca taacagtggt gggcaacttg ggaatgatgg 361 cactcatctt cacagactcc catctccaaa gcccaatgta tttcttcctc aatgtcctct 421 cgtttcttga tatttgttac tcttctgtgg tcacacctaa gctcttggtc aacttcctgg 481 tctctgacaa gtccatctct tttgagggct gtgtggtcca gctcgccttc tttgtagtgc 541 atgtgacagc tgagagcttc ctgctggcct ccatggccta tgaccgcttc ctagccatct 601 gtcaacccct ccattatggt tctatcatga ccagggggac ctgtctccag ctggtagctg 661 tgtcctatgc atttggtgga gccaactccg ctatccagac tggaaatgtc tttgccctgc 721 ctttctgtgg gcccaaccag ctaacacact actactgtga cataccaccc cttctccacc 781 tggcttgtgc caacacagcc acagcaagag tggtcctcta tgtcttttct gctctggtca 841 cccttctgcc tgctgcagtc attctcacct cctactgctt ggtcttggtg gccattggga 901 ggatgcgctc agtagcaggg agggagaagg acctctccac ttgtgcctcc cactttctgg 961 ccattgccat tttctatggc accgtggttt tcacctatgt tcagccccat ggatctacta 1021 acaataccaa tggccaagta gtgtccgtct tctacaccat cataattccc atgctcaatc 1081 ccttcatcta tagcctccgc aacaaggagg tgaagggcgc tctgcagagg aagcttcagg 1141 tcaacatctt tcccggctga gccctgcaag gtgacttgtt ggaatgagga aggtataaca 1201 tcttccaaag cacactatga attaacgtaa ccaatcaaga gcagccctgg ttttggagga 1261 gatagaaaaa gtaaatgaga aacagcaaat atatcttgta cagaccatta cagtttataa 1321 agcatcttct tacccattat catatcaaat tctcaccacc //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on