Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Download features.
Download gene features.
GenBank: AF130062.2
FASTA Graphics
LOCUS AF130062 1287 bp mRNA linear HTC 05-OCT-2012 DEFINITION Homo sapiens clone FLB7715 PRO2051 mRNA, complete cds. ACCESSION AF130062 VERSION AF130062.2 KEYWORDS HTC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1287) AUTHORS Zhang,C., Yu,Y., Zhang,S., Wei,H., Bi,J., Zhou,G., Dong,C., Zai,Y., Xu,W., Gao,F., Liu,M. and He,F. TITLE Functional prediction of the coding sequences of 75 new genes deduced by analysis of cDNA clones from human fetal liver JOURNAL Unpublished REFERENCE 2 (bases 1 to 1287) AUTHORS Zhang,C., Yu,Y., Zhang,S., Wei,H., Bi,J., Zhou,G., Dong,C., Zai,Y., Xu,W., Gao,F., Liu,M. and He,F. TITLE Direct Submission JOURNAL Submitted (23-FEB-1999) Department of Experimental Hematology, Institute of Radiation Medicine, Beijing Taiping Road 27, Beijing, Beijing 100850, P. R. China COMMENT On Oct 5, 2012 this sequence version replaced AF130062.1. FEATURES Location/Qualifiers source 1..1287 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /clone="FLB7715" /tissue_type="liver" /dev_stage="fetus" CDS 557..838 /inference="non-experimental evidence, no additional details recorded" /note="predicted protein of HQ2051" /codon_start=1 /product="PRO2051" /protein_id="AAG35490.1" /translation="MQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDV VLETAWRHNIMDFAMPYFIQVMKEYLTKVMTLLSVFRTSFLACKILHAH" ORIGIN 1 tttttttttt tttttaaggc tctgcgaaca tcaatagatg cttatgacaa ctttgacaat 61 atctcgcttg ctcagcgttt ggaaaaacat gaactcattg agttcaggag aattgctgct 121 tatctcttca aaggcaacaa tcgctggaaa cagagtgtag agctgtgcaa gaaagacagc 181 ctttacaagg ttgataaagt tgcggggcag gggctgtttt aaaccaggcc taaaatggtg 241 ttacaagtga ttataatcta taaataaaag tattggtttt gtgaatatga gagctgactt 301 taaggcaatt taagttaatg gatttcttga ttctaggggc tctcttatgt taaggtcaaa 361 cttgtctggg gaaaaaaaaa gcttttagct tatctcttct ttgaaaattt taatttaaat 421 gatacaacta ggaggctttt ttccccttgc aaaaccagat ttatattgga aagcttccat 481 tgtttttctt ggtttactag ttcagtatgt ggggtctaat gtttttgact ttcactattt 541 ctttgaatag gatgcaatgc agtatgcttc tgaatctaaa gatactgaat tggctgaaga 601 actcctgcag tggtttttgc aggaagaaaa aagagagtgc tttggagctt gtctgtttac 661 ctgttacgat cttttaaggc cagatgtcgt cctagaaact gcatggaggc acaatatcat 721 ggattttgcc atgccctatt tcatccaggt catgaaggag tacttgacaa aggtaatgac 781 tcttctaagt gtattcagaa ctagtttcct tgcatgtaaa attctacatg cacattaatt 841 tttttaaatg cttttttctt tagtagaagt aagtcattta gtcgatcata aaatattcct 901 gttcttttga aatttttttt taatagctga caaatgacac tgattggaag gggaactcaa 961 atgtagctgt ttaccctcag tgtatttatg agggtgaaaa taatctatgt atttttttat 1021 ttaaaaaact ttgataaatt ttatttcaaa atagtatttt tctcaaaatc agttcttgta 1081 actcaaatat tcatgactag tattgtagat tcccttttat ttggttggtt cctgacttta 1141 atgatgtcta tgcctgtttc ccctggggaa gctgcatgta tattcttaac atccttttaa 1201 tcttcacaat ttttttgata gtttaacccc tgatttaaaa ataccatagg aggtgaacat 1261 gggaaaaaaa aaaaaaaaaa aagcggc //
Whole sequence Selected region from: to:
All features Gene, RNA, and CDS features only
Show sequence Show reverse complement Show gap features
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on