LOCUS NM_139032 2780 bp mRNA linear PRI 12-MAY-2019
DEFINITION Homo sapiens mitogen-activated protein kinase 7 (MAPK7), transcript
variant 2, mRNA.
ACCESSION NM_139032
VERSION NM_139032.2
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2780)
AUTHORS Zhang P, Du J, Wang L, Niu L, Zhao Y, Tang G, Jiang Y, Shuai S, Bai
L, Li X, Wang J, Zhang S and Zhu L.
TITLE MicroRNA-143a-3p modulates preadipocyte proliferation and
differentiation by targeting MAPK7
JOURNAL Biomed. Pharmacother. 108, 531-539 (2018)
PUBMED 30243086
REMARK GeneRIF: MAPK7 is a target gene of miR-143a-3p in 3T3-L1 cells.
REFERENCE 2 (bases 1 to 2780)
AUTHORS Dompe N, Klijn C, Watson SA, Leng K, Port J, Cuellar T, Watanabe C,
Haley B, Neve R, Evangelista M and Stokoe D.
TITLE A CRISPR screen identifies MAPK7 as a target for combination with
MEK inhibition in KRAS mutant NSCLC
JOURNAL PLoS ONE 13 (6), e0199264 (2018)
PUBMED 29912950
REMARK GeneRIF: These data highlight that MAPK7 represents a promising
target for combination treatment with MEK inhibition in KRAS mutant
Non Small Cell Lung Carcinoma.
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 2780)
AUTHORS Adam C, Gluck L, Ebert R, Goebeler M, Jakob F and Schmidt M.
TITLE The MEK5/ERK5 mitogen-activated protein kinase cascade is an
effector pathway of bone-sustaining bisphosphonates that regulates
osteogenic differentiation and mineralization
JOURNAL Bone 111, 49-58 (2018)
PUBMED 29567200
REMARK GeneRIF: The study provide evidence that nitrogen-containing
bisphosphonates activate the MEK5/ERK5 cascade and reveal an
essential role of ERK5 in osteogenic differentiation and
mineralization of skeletal precursors.
REFERENCE 4 (bases 1 to 2780)
AUTHORS Giurisato E, Xu Q, Lonardi S, Telfer B, Russo I, Pearson A, Finegan
KG, Wang W, Wang J, Gray NS, Vermi W, Xia Z and Tournier C.
TITLE Myeloid ERK5 deficiency suppresses tumor growth by blocking
protumor macrophage polarization via STAT3 inhibition
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 115 (12), E2801-E2810 (2018)
PUBMED 29507229
REMARK GeneRIF: ERK5 is highly expressed in human tumor-associated
macrophages.ERK5 plays a role in the tumor-associated macrophage
polarization via STAT3.
REFERENCE 5 (bases 1 to 2780)
AUTHORS Zhou T, Chen C, Xu C, Zhou H, Gao B, Su D, Liao Z, Li Y, Yang S and
Su P.
TITLE Mutant MAPK7-Induced Idiopathic Scoliosis is Linked to Impaired
Osteogenesis
JOURNAL Cell. Physiol. Biochem. 48 (3), 880-890 (2018)
PUBMED 30032135
REMARK GeneRIF: The reduction of MAPK7 pathway activity and the loss of
MAPK7 gene expression induce damaged osteogenesis via RPS6KA3
and/or its substrates.
REFERENCE 6 (bases 1 to 2780)
AUTHORS Kato Y, Tapping RI, Huang S, Watson MH, Ulevitch RJ and Lee JD.
TITLE Bmk1/Erk5 is required for cell proliferation induced by epidermal
growth factor
JOURNAL Nature 395 (6703), 713-716 (1998)
PUBMED 9790194
REFERENCE 7 (bases 1 to 2780)
AUTHORS English JM, Pearson G, Baer R and Cobb MH.
TITLE Identification of substrates and regulators of the
mitogen-activated protein kinase ERK5 using chimeric protein
kinases
JOURNAL J. Biol. Chem. 273 (7), 3854-3860 (1998)
PUBMED 9461566
REFERENCE 8 (bases 1 to 2780)
AUTHORS Purandare SM, Lee JD and Patel PI.
TITLE Assignment of big MAP kinase (PRKM7) to human chromosome 17 band
p11.2 with somatic cell hybrids
JOURNAL Cytogenet. Cell Genet. 83 (3-4), 258-259 (1998)
PUBMED 10072598
REFERENCE 9 (bases 1 to 2780)
AUTHORS Lee JD, Ulevitch RJ and Han J.
TITLE Primary structure of BMK1: a new mammalian map kinase
JOURNAL Biochem. Biophys. Res. Commun. 213 (2), 715-724 (1995)
PUBMED 7646528
REFERENCE 10 (bases 1 to 2780)
AUTHORS Zhou G, Bao ZQ and Dixon JE.
TITLE Components of a new human protein kinase signal transduction
pathway
JOURNAL J. Biol. Chem. 270 (21), 12665-12669 (1995)
PUBMED 7759517
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DB133227.1, BC007404.2 and
BC030134.1.
[WARNING] On May 31, 2019 this sequence was replaced by
NM_139032.3.
On Oct 16, 2008 this sequence version replaced NM_139032.1.
Summary: The protein encoded by this gene is a member of the MAP
kinase family. MAP kinases act as an integration point for multiple
biochemical signals, and are involved in a wide variety of cellular
processes such as proliferation, differentiation, transcription
regulation and development. This kinase is specifically activated
by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is
involved in the downstream signaling processes of various receptor
molecules including receptor type kinases, and G protein-coupled
receptors. In response to extracelluar signals, this kinase
translocates to cell nucleus, where it regulates gene expression by
phosphorylating, and activating different transcription factors.
Four alternatively spliced transcript variants of this gene
encoding two distinct isoforms have been reported. [provided by
RefSeq, Jul 2008].
Transcript Variant: This variant (2) lacks a segment in the 5'
region, which includes the translation start codon, when compared
to variant 1. The translation of this transcript begins at a
downstream in-frame start codon, and thus results in an N-terminal
truncated isoform (2), as compared to isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC007404.2 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA1965299, SAMEA2142680
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-32 DB133227.1 1-32
33-2742 BC007404.2 1-2710
2743-2780 BC030134.1 2782-2819
FEATURES Location/Qualifiers
source 1..2780
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="17"
/map="17p11.2"
gene 1..2780
/gene="MAPK7"
/gene_synonym="BMK1; ERK4; ERK5; PRKM7"
/note="mitogen-activated protein kinase 7"
/db_xref="GeneID:5598"
/db_xref="HGNC:HGNC:6880"
/db_xref="MIM:602521"
exon 1..381
/gene="MAPK7"
/gene_synonym="BMK1; ERK4; ERK5; PRKM7"
/inference="alignment:Splign:2.1.0"
misc_feature 374..376
/gene="MAPK7"
/gene_synonym="BMK1; ERK4; ERK5; PRKM7"
/note="upstream in-frame stop codon"
exon 382..1460
/gene="MAPK7"
/gene_synonym="BMK1; ERK4; ERK5; PRKM7"
/inference="alignment:Splign:2.1.0"
CDS 401..2434
/gene="MAPK7"
/gene_synonym="BMK1; ERK4; ERK5; PRKM7"
/EC_number="2.7.11.24"
/note="isoform 2 is encoded by transcript variant 2;
extracellular-signal-regulated kinase 5; BMK1 kinase; big
MAP kinase 1; BMK-1; ERK-5; MAPK 7; MAP kinase 7"
/codon_start=1
/product="mitogen-activated protein kinase 7 isoform 2"
/protein_id="NP_620601.1"
/db_xref="CCDS:CCDS11207.1"
/db_xref="GeneID:5598"
/db_xref="HGNC:HGNC:6880"
/db_xref="MIM:602521"
/translation="MESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDL
KPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQ
AIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQ
SLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEP
DCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCP
DVEMPSPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKDGAISD
NTKAALKAALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKER
EKRRQERERKERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPALTSVPAP
APAPTPTPTPVQPTSPPPGPVAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPG
PIPVPAPPQIATSTSLLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMS
ESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGP
QDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP"
exon 1461..2146
/gene="MAPK7"
/gene_synonym="BMK1; ERK4; ERK5; PRKM7"
/inference="alignment:Splign:2.1.0"
exon 2147..2280
/gene="MAPK7"
/gene_synonym="BMK1; ERK4; ERK5; PRKM7"
/inference="alignment:Splign:2.1.0"
exon 2281..2747
/gene="MAPK7"
/gene_synonym="BMK1; ERK4; ERK5; PRKM7"
/inference="alignment:Splign:2.1.0"
polyA_site 2747
/gene="MAPK7"
/gene_synonym="BMK1; ERK4; ERK5; PRKM7"
ORIGIN
1 acagctcggt tccagcgagg gctccgccca cccgcgggct ccgcagagga gcagaggttg
61 ggcggccgcc tcggttaact ccgctgcagc ccaaagcacg ggaatcgcgg gacagacaaa
121 cgagcggagg gaagatacct agaagccagg aaaccgcgag ctgcagtcca acttggccgg
181 aagctgcgga gaggctcagc caccggaagt cagtggaggg ttcggccgga cgctctagaa
241 tcccggagga ccgggatctc tgtggttggc cgtgacgggc accctctacc ggggatgaca
301 cattcccaga gctcctggga ccaagcaaat ggcggacaca attccctggg cggaagggga
361 cttcgggagc cagtagccaa gctacgtggt cctggacctg atggaaagcg acctgcacca
421 gatcatccac tcctcacagc ccctcacact ggaacacgtg cgctacttcc tgtaccaact
481 gctgcggggc ctgaagtaca tgcactcggc tcaggtcatc caccgtgacc tgaagccctc
541 caacctattg gtgaatgaga actgtgagct caagattggt gactttggta tggctcgtgg
601 cctgtgcacc tcgcccgctg aacatcagta cttcatgact gagtatgtgg ccacgcgctg
661 gtaccgtgcg cccgagctca tgctctcttt gcatgagtat acacaggcta ttgacctctg
721 gtctgtgggc tgcatctttg gtgagatgct ggcccggcgc cagctcttcc caggcaaaaa
781 ctatgtacac cagctacagc tcatcatgat ggtgctgggt accccatcac cagccgtgat
841 tcaggctgtg ggggctgaga gggtgcgggc ctatatccag agcttgccac cacgccagcc
901 tgtgccctgg gagacagtgt acccaggtgc cgaccgccag gccctatcac tgctgggtcg
961 catgctgcgt tttgagccca gcgctcgcat ctcagcagct gctgcccttc gccacccttt
1021 cctggccaag taccatgatc ctgatgatga gcctgactgt gccccgccct ttgactttgc
1081 ctttgaccgc gaagccctca ctcgggagcg cattaaggag gccattgtgg ctgaaattga
1141 ggacttccat gcaaggcgtg agggcatccg ccaacagatc cgcttccagc cttctctaca
1201 gcctgtggct agtgagcctg gctgtccaga tgttgaaatg cccagtccct gggctcccag
1261 tggggactgt gccatggagt ctccaccacc agccccgcca ccatgccccg gccctgcacc
1321 tgacaccatt gatctgaccc tgcagccacc tccaccagtc agtgagcctg ccccaccaaa
1381 gaaagatggt gccatctcag acaatactaa ggctgccctt aaagctgccc tgctcaagtc
1441 tttgaggagc cggctcagag atggccccag cgcacccctg gaggctcctg agcctcggaa
1501 gccggtgaca gcccaggagc gccagcggga gcgggaggag aagcggcgga ggcggcaaga
1561 acgagccaag gagcgggaga aacggcggca ggagcgggag cgaaaggaac ggggggctgg
1621 ggcctctggg ggcccctcca ctgacccctt ggctggacta gtgctcagtg acaatgacag
1681 aagcctgttg gaacgctgga ctcgaatggc ccggcccgca gccccagccc tcacctctgt
1741 gccggcccct gccccagcgc caacgccaac cccaacccca gtccaaccta ccagtcctcc
1801 tcctggccct gtagcccagc ccactggccc gcaaccacaa tctgcgggct ctacctctgg
1861 ccctgtaccc cagcctgcct gcccaccccc tggccctgca ccccacccca ctggccctcc
1921 tgggcccatc cctgtccccg cgccacccca gattgccacc tccaccagcc tcctggctgc
1981 ccagtcactt gtgccacccc ctgggctgcc tggctccagc accccaggag ttttgcctta
2041 cttcccacct ggcctgccgc ccccagacgc cgggggagcc cctcagtctt ccatgtcaga
2101 gtcacctgat gtcaaccttg tgacccagca gctatctaag tcacaggtgg aggaccccct
2161 gccccctgtg ttctcaggca caccaaaggg cagtggggct ggctacggtg ttggctttga
2221 cctggaggaa ttcttaaacc agtctttcga catgggcgtg gctgatgggc cacaggatgg
2281 ccaggcagat tcagcctctc tctcagcctc cctgcttgct gactggctcg aaggccatgg
2341 catgaaccct gccgatattg agtccctgca gcgtgagatc cagatggact ccccaatgct
2401 gctggctgac ctgcctgacc tccaggaccc ctgaggcccc cagcctgtgc cttgctgcca
2461 cagtagacct agttccagga tccatgggag cattctcaaa ggctttagcc ctggacccag
2521 caggtgaggc tcggcttgga ttattctgca ggttcatctc agacccacct ttcagcctta
2581 agcagccacc tgagccacca ccgagccatg gcaggatcgg gagaccccaa ctccccctga
2641 acaatccttt tcagtattat atttttatta ttattatgtt attattacac tgtctttttg
2701 ccatcaaaat gaggcctgtg aaatacaagg ttcccttctg cacctgaaaa aaaaaaaaaa
2761 aaaaaaaaaa aaaaaaaaaa
//