U.S. flag

An official website of the United States government

Homo sapiens mitogen-activated protein kinase 7 (MAPK7), transcript variant 2, mRNA

NCBI Reference Sequence: NM_139032.2

FASTA Graphics 

LOCUS       NM_139032               2780 bp    mRNA    linear   PRI 12-MAY-2019
DEFINITION  Homo sapiens mitogen-activated protein kinase 7 (MAPK7), transcript
            variant 2, mRNA.
ACCESSION   NM_139032
VERSION     NM_139032.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2780)
  AUTHORS   Zhang P, Du J, Wang L, Niu L, Zhao Y, Tang G, Jiang Y, Shuai S, Bai
            L, Li X, Wang J, Zhang S and Zhu L.
  TITLE     MicroRNA-143a-3p modulates preadipocyte proliferation and
            differentiation by targeting MAPK7
  JOURNAL   Biomed. Pharmacother. 108, 531-539 (2018)
   PUBMED   30243086
  REMARK    GeneRIF: MAPK7 is a target gene of miR-143a-3p in 3T3-L1 cells.
REFERENCE   2  (bases 1 to 2780)
  AUTHORS   Dompe N, Klijn C, Watson SA, Leng K, Port J, Cuellar T, Watanabe C,
            Haley B, Neve R, Evangelista M and Stokoe D.
  TITLE     A CRISPR screen identifies MAPK7 as a target for combination with
            MEK inhibition in KRAS mutant NSCLC
  JOURNAL   PLoS ONE 13 (6), e0199264 (2018)
   PUBMED   29912950
  REMARK    GeneRIF: These data highlight that MAPK7 represents a promising
            target for combination treatment with MEK inhibition in KRAS mutant
            Non Small Cell Lung Carcinoma.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 2780)
  AUTHORS   Adam C, Gluck L, Ebert R, Goebeler M, Jakob F and Schmidt M.
  TITLE     The MEK5/ERK5 mitogen-activated protein kinase cascade is an
            effector pathway of bone-sustaining bisphosphonates that regulates
            osteogenic differentiation and mineralization
  JOURNAL   Bone 111, 49-58 (2018)
   PUBMED   29567200
  REMARK    GeneRIF: The study provide evidence that nitrogen-containing
            bisphosphonates activate the MEK5/ERK5 cascade and reveal an
            essential role of ERK5 in osteogenic differentiation and
            mineralization of skeletal precursors.
REFERENCE   4  (bases 1 to 2780)
  AUTHORS   Giurisato E, Xu Q, Lonardi S, Telfer B, Russo I, Pearson A, Finegan
            KG, Wang W, Wang J, Gray NS, Vermi W, Xia Z and Tournier C.
  TITLE     Myeloid ERK5 deficiency suppresses tumor growth by blocking
            protumor macrophage polarization via STAT3 inhibition
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 115 (12), E2801-E2810 (2018)
   PUBMED   29507229
  REMARK    GeneRIF: ERK5 is highly expressed in human tumor-associated
            macrophages.ERK5 plays a role in the tumor-associated macrophage
            polarization via STAT3.
REFERENCE   5  (bases 1 to 2780)
  AUTHORS   Zhou T, Chen C, Xu C, Zhou H, Gao B, Su D, Liao Z, Li Y, Yang S and
            Su P.
  TITLE     Mutant MAPK7-Induced Idiopathic Scoliosis is Linked to Impaired
            Osteogenesis
  JOURNAL   Cell. Physiol. Biochem. 48 (3), 880-890 (2018)
   PUBMED   30032135
  REMARK    GeneRIF: The reduction of MAPK7 pathway activity and the loss of
            MAPK7 gene expression induce damaged osteogenesis via RPS6KA3
            and/or its substrates.
REFERENCE   6  (bases 1 to 2780)
  AUTHORS   Kato Y, Tapping RI, Huang S, Watson MH, Ulevitch RJ and Lee JD.
  TITLE     Bmk1/Erk5 is required for cell proliferation induced by epidermal
            growth factor
  JOURNAL   Nature 395 (6703), 713-716 (1998)
   PUBMED   9790194
REFERENCE   7  (bases 1 to 2780)
  AUTHORS   English JM, Pearson G, Baer R and Cobb MH.
  TITLE     Identification of substrates and regulators of the
            mitogen-activated protein kinase ERK5 using chimeric protein
            kinases
  JOURNAL   J. Biol. Chem. 273 (7), 3854-3860 (1998)
   PUBMED   9461566
REFERENCE   8  (bases 1 to 2780)
  AUTHORS   Purandare SM, Lee JD and Patel PI.
  TITLE     Assignment of big MAP kinase (PRKM7) to human chromosome 17 band
            p11.2 with somatic cell hybrids
  JOURNAL   Cytogenet. Cell Genet. 83 (3-4), 258-259 (1998)
   PUBMED   10072598
REFERENCE   9  (bases 1 to 2780)
  AUTHORS   Lee JD, Ulevitch RJ and Han J.
  TITLE     Primary structure of BMK1: a new mammalian map kinase
  JOURNAL   Biochem. Biophys. Res. Commun. 213 (2), 715-724 (1995)
   PUBMED   7646528
REFERENCE   10 (bases 1 to 2780)
  AUTHORS   Zhou G, Bao ZQ and Dixon JE.
  TITLE     Components of a new human protein kinase signal transduction
            pathway
  JOURNAL   J. Biol. Chem. 270 (21), 12665-12669 (1995)
   PUBMED   7759517
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DB133227.1, BC007404.2 and
            BC030134.1.
            
            [WARNING] On May 31, 2019 this sequence was replaced by
            NM_139032.3.
            
            On Oct 16, 2008 this sequence version replaced NM_139032.1.
            
            Summary: The protein encoded by this gene is a member of the MAP
            kinase family. MAP kinases act as an integration point for multiple
            biochemical signals, and are involved in a wide variety of cellular
            processes such as proliferation, differentiation, transcription
            regulation and development. This kinase is specifically activated
            by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is
            involved in the downstream signaling processes of various receptor
            molecules including receptor type kinases, and G protein-coupled
            receptors. In response to extracelluar signals, this kinase
            translocates to cell nucleus, where it regulates gene expression by
            phosphorylating, and activating different transcription factors.
            Four alternatively spliced transcript variants of this gene
            encoding two distinct isoforms have been reported. [provided by
            RefSeq, Jul 2008].
            
            Transcript Variant: This variant (2) lacks a segment in the 5'
            region, which includes the translation start codon, when compared
            to variant 1. The translation of this transcript begins at a
            downstream in-frame start codon, and thus results in an N-terminal
            truncated isoform (2), as compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC007404.2 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA2142680
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-32                DB133227.1         1-32
            33-2742             BC007404.2         1-2710
            2743-2780           BC030134.1         2782-2819
FEATURES             Location/Qualifiers
     source          1..2780
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17p11.2"
     gene            1..2780
                     /gene="MAPK7"
                     /gene_synonym="BMK1; ERK4; ERK5; PRKM7"
                     /note="mitogen-activated protein kinase 7"
                     /db_xref="GeneID:5598"
                     /db_xref="HGNC:HGNC:6880"
                     /db_xref="MIM:602521"
     exon            1..381
                     /gene="MAPK7"
                     /gene_synonym="BMK1; ERK4; ERK5; PRKM7"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    374..376
                     /gene="MAPK7"
                     /gene_synonym="BMK1; ERK4; ERK5; PRKM7"
                     /note="upstream in-frame stop codon"
     exon            382..1460
                     /gene="MAPK7"
                     /gene_synonym="BMK1; ERK4; ERK5; PRKM7"
                     /inference="alignment:Splign:2.1.0"
     CDS             401..2434
                     /gene="MAPK7"
                     /gene_synonym="BMK1; ERK4; ERK5; PRKM7"
                     /EC_number="2.7.11.24"
                     /note="isoform 2 is encoded by transcript variant 2;
                     extracellular-signal-regulated kinase 5; BMK1 kinase; big
                     MAP kinase 1; BMK-1; ERK-5; MAPK 7; MAP kinase 7"
                     /codon_start=1
                     /product="mitogen-activated protein kinase 7 isoform 2"
                     /protein_id="NP_620601.1"
                     /db_xref="CCDS:CCDS11207.1"
                     /db_xref="GeneID:5598"
                     /db_xref="HGNC:HGNC:6880"
                     /db_xref="MIM:602521"
                     /translation="MESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDL
                     KPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQ
                     AIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQ
                     SLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEP
                     DCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCP
                     DVEMPSPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKDGAISD
                     NTKAALKAALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKER
                     EKRRQERERKERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPALTSVPAP
                     APAPTPTPTPVQPTSPPPGPVAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPG
                     PIPVPAPPQIATSTSLLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMS
                     ESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGP
                     QDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP"
     exon            1461..2146
                     /gene="MAPK7"
                     /gene_synonym="BMK1; ERK4; ERK5; PRKM7"
                     /inference="alignment:Splign:2.1.0"
     exon            2147..2280
                     /gene="MAPK7"
                     /gene_synonym="BMK1; ERK4; ERK5; PRKM7"
                     /inference="alignment:Splign:2.1.0"
     exon            2281..2747
                     /gene="MAPK7"
                     /gene_synonym="BMK1; ERK4; ERK5; PRKM7"
                     /inference="alignment:Splign:2.1.0"
     polyA_site      2747
                     /gene="MAPK7"
                     /gene_synonym="BMK1; ERK4; ERK5; PRKM7"
ORIGIN      
        1 acagctcggt tccagcgagg gctccgccca cccgcgggct ccgcagagga gcagaggttg
       61 ggcggccgcc tcggttaact ccgctgcagc ccaaagcacg ggaatcgcgg gacagacaaa
      121 cgagcggagg gaagatacct agaagccagg aaaccgcgag ctgcagtcca acttggccgg
      181 aagctgcgga gaggctcagc caccggaagt cagtggaggg ttcggccgga cgctctagaa
      241 tcccggagga ccgggatctc tgtggttggc cgtgacgggc accctctacc ggggatgaca
      301 cattcccaga gctcctggga ccaagcaaat ggcggacaca attccctggg cggaagggga
      361 cttcgggagc cagtagccaa gctacgtggt cctggacctg atggaaagcg acctgcacca
      421 gatcatccac tcctcacagc ccctcacact ggaacacgtg cgctacttcc tgtaccaact
      481 gctgcggggc ctgaagtaca tgcactcggc tcaggtcatc caccgtgacc tgaagccctc
      541 caacctattg gtgaatgaga actgtgagct caagattggt gactttggta tggctcgtgg
      601 cctgtgcacc tcgcccgctg aacatcagta cttcatgact gagtatgtgg ccacgcgctg
      661 gtaccgtgcg cccgagctca tgctctcttt gcatgagtat acacaggcta ttgacctctg
      721 gtctgtgggc tgcatctttg gtgagatgct ggcccggcgc cagctcttcc caggcaaaaa
      781 ctatgtacac cagctacagc tcatcatgat ggtgctgggt accccatcac cagccgtgat
      841 tcaggctgtg ggggctgaga gggtgcgggc ctatatccag agcttgccac cacgccagcc
      901 tgtgccctgg gagacagtgt acccaggtgc cgaccgccag gccctatcac tgctgggtcg
      961 catgctgcgt tttgagccca gcgctcgcat ctcagcagct gctgcccttc gccacccttt
     1021 cctggccaag taccatgatc ctgatgatga gcctgactgt gccccgccct ttgactttgc
     1081 ctttgaccgc gaagccctca ctcgggagcg cattaaggag gccattgtgg ctgaaattga
     1141 ggacttccat gcaaggcgtg agggcatccg ccaacagatc cgcttccagc cttctctaca
     1201 gcctgtggct agtgagcctg gctgtccaga tgttgaaatg cccagtccct gggctcccag
     1261 tggggactgt gccatggagt ctccaccacc agccccgcca ccatgccccg gccctgcacc
     1321 tgacaccatt gatctgaccc tgcagccacc tccaccagtc agtgagcctg ccccaccaaa
     1381 gaaagatggt gccatctcag acaatactaa ggctgccctt aaagctgccc tgctcaagtc
     1441 tttgaggagc cggctcagag atggccccag cgcacccctg gaggctcctg agcctcggaa
     1501 gccggtgaca gcccaggagc gccagcggga gcgggaggag aagcggcgga ggcggcaaga
     1561 acgagccaag gagcgggaga aacggcggca ggagcgggag cgaaaggaac ggggggctgg
     1621 ggcctctggg ggcccctcca ctgacccctt ggctggacta gtgctcagtg acaatgacag
     1681 aagcctgttg gaacgctgga ctcgaatggc ccggcccgca gccccagccc tcacctctgt
     1741 gccggcccct gccccagcgc caacgccaac cccaacccca gtccaaccta ccagtcctcc
     1801 tcctggccct gtagcccagc ccactggccc gcaaccacaa tctgcgggct ctacctctgg
     1861 ccctgtaccc cagcctgcct gcccaccccc tggccctgca ccccacccca ctggccctcc
     1921 tgggcccatc cctgtccccg cgccacccca gattgccacc tccaccagcc tcctggctgc
     1981 ccagtcactt gtgccacccc ctgggctgcc tggctccagc accccaggag ttttgcctta
     2041 cttcccacct ggcctgccgc ccccagacgc cgggggagcc cctcagtctt ccatgtcaga
     2101 gtcacctgat gtcaaccttg tgacccagca gctatctaag tcacaggtgg aggaccccct
     2161 gccccctgtg ttctcaggca caccaaaggg cagtggggct ggctacggtg ttggctttga
     2221 cctggaggaa ttcttaaacc agtctttcga catgggcgtg gctgatgggc cacaggatgg
     2281 ccaggcagat tcagcctctc tctcagcctc cctgcttgct gactggctcg aaggccatgg
     2341 catgaaccct gccgatattg agtccctgca gcgtgagatc cagatggact ccccaatgct
     2401 gctggctgac ctgcctgacc tccaggaccc ctgaggcccc cagcctgtgc cttgctgcca
     2461 cagtagacct agttccagga tccatgggag cattctcaaa ggctttagcc ctggacccag
     2521 caggtgaggc tcggcttgga ttattctgca ggttcatctc agacccacct ttcagcctta
     2581 agcagccacc tgagccacca ccgagccatg gcaggatcgg gagaccccaa ctccccctga
     2641 acaatccttt tcagtattat atttttatta ttattatgtt attattacac tgtctttttg
     2701 ccatcaaaat gaggcctgtg aaatacaagg ttcccttctg cacctgaaaa aaaaaaaaaa
     2761 aaaaaaaaaa aaaaaaaaaa
//
401..2434
/gene="MAPK7"
/gene_synonym="BMK1; ERK4; ERK5; PRKM7"
/EC_number="2.7.11.24"
/note="isoform 2 is encoded by transcript variant 2;
extracellular-signal-regulated kinase 5; BMK1 kinase; big
MAP kinase 1; BMK-1; ERK-5; MAPK 7; MAP kinase 7"
/codon_start=1
/product="mitogen-activated protein kinase 7 isoform 2"
/protein_id="NP_620601.1"
/db_xref="CCDS:CCDS11207.1"
/db_xref="GeneID:5598"
/db_xref="HGNC:HGNC:6880"
/db_xref="MIM:602521"
/translation="MESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDL
KPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQ
AIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQ
SLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEP
DCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCP
DVEMPSPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKDGAISD
NTKAALKAALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKER
EKRRQERERKERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPALTSVPAP
APAPTPTPTPVQPTSPPPGPVAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPG
PIPVPAPPQIATSTSLLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMS
ESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGP
QDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP"
Feature NM_139032 : 1 segment
Display: FASTA GenBank Help
Details

Supplemental Content

Change region shown

Customize view

Recent activity

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

See more...
External link. Please review our privacy policy.